TkA03G344050 | RubberDandelionOmics

Gene overview

TkA03G344050

Reference: TK1151 Chr: Chr03 Coordinates: 84629670-84632893 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1404 bp · TkA03G344050|TK1151|cDNA

TAAAAAACGTATATAATGTTATTGATTTAACTAAAAGAACATTGATCAATTTTCTTTTGATAGGTTTCATGTAATTTGCCCAAAAGACAATTTTACCAACCAGGGTGACGAGTGACGATTGCGACGGTGGTTGGTGAGATCCCCAACTCAGTTTCAAACTTATAATGACATAGATTCGAAGTTTCGTCAGCACCGCCGCCTCCGCTTTCTGCAGCACCGCCTTCTAGTCGTCGGCCGTTCACCGCCTTCTACAGCACCGC...

CDS

Download CDS FASTA

885 bp · TkA03G344050|TK1151|CDS

ATGGAAGGATTGATCTGTTCACGAATAATTCCTATTCGTGCTTATGGTAATCAAGGAAACACCCCCCTCTTTCCAACATATACATCAAGCAAAAATCGAATCTTTTATGGTCCAATCAGAATGATGGGACCTTCCACATCATCCAACTCAAAAGCCGGCTCCATTAAGCCATTAGCAGCCTCCTCATCAGGCATATTCGACAATACATTGCCTTCCAAAGAGGTTCTTGATTTATGGCAGAAAGCTGATGCTGTATGCTT...

Protein

Download Protein FASTA

294 aa · TkA03G344050|TK1151|PROTEIN

MEGLICSRIIPIRAYGNQGNTPLFPTYTSSKNRIFYGPIRMMGPSTSSNSKAGSIKPLAASSSGIFDNTLPSKEVLDLWQKADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSSSKVQDFLEKNPPKLSPGIMELVQKLKESGKTVYLISGGFRQMINPVASILGVPPENIFANQLLFKNSGEFSGFDANEPTSRSGGKPTAVELIRKTHGYKTVVMIGDGATDLEARKPGCA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G344050`
TK1151 ID	TkA03G344050
OH-1004 ID	LXL04_008700
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 71.533 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G344050

Location Chr03:84629670-84632893 (-)

Description Similar to PSP: Phosphoserine phosphatase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18640`	Catalyzes the last step in the plastidial phosphorylated pathway of serine biosynthesis (PPSB).	The phosphorylated pathway of serine biosynthesis is essential both for male gametophyte and embryo development and for root growth in Arabidopsis.2013 · DOI: 10.1105/tpc.113.112359

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008700 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000096 sulfur amino acid metabolic process Biological Process

GO:0006563 L-serine metabolic process Biological Process

GO:0006564 L-serine biosynthetic process Biological Process

GO:0009555 pollen development Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0031667 response to nutrient levels Biological Process

GO:0033574 response to testosterone Biological Process

GO:0048364 root development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G18640

bta:533630

hsa:5723

mmu:100678

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.940

Rank 1 · TkA03G344050 · TK1151

Mitochondrion0.086

Rank 2 · TkA03G344050 · TK1151

Nucleus0.027

Rank 3 · TkA03G344050 · TK1151

Cytoplasm0.025

Rank 4 · TkA03G344050 · TK1151

Cell membrane0.012

Rank 5 · TkA03G344050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03767Acid_phosphat_B77-93 aa

PF00702Hydrolase83-254 aa

PF12710HAD86-254 aa

PF03767Acid_phosphat_B143-254 aa

PF13419HAD_2148-185 aa

PF13419HAD_2240-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G344050	`PF03767`	Acid_phosphat_B	77	93	0.00038	20.7
TkA03G344050	`PF00702`	Hydrolase	83	254	2.2e-18	68.0
TkA03G344050	`PF12710`	HAD	86	254	3.9e-13	50.9
TkA03G344050	`PF03767`	Acid_phosphat_B	143	254	0.00038	20.7
TkA03G344050	`PF13419`	HAD_2	148	185	0.4	11.4
TkA03G344050	`PF13419`	HAD_2	240	254	0.4	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82796`	Arabidopsis thaliana	sp\|O82796\|SERC_ARATH Phosphoserine phosphatase, chloroplastic	65.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card