TkA03G308660 | RubberDandelionOmics

Gene overview

TkA03G308660

Reference: TK1151 Chr: Chr03 Coordinates: 75886227-75892793 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

945 bp · TkA03G308660|TK1151|cDNA

ATGTCAACAGAATTATATATCAAAGAGTCCATGAGATTTAGTTACTCAGAGATTCATCTTGCCACAAATTATCTTTCAAAAGAAAACCTGTTAGGTGAAGGAGGTTATGGTCTTGTTTACAAGGGTCAACTCGATGATGGCCAAATCAGAGCTGCTAAGGTGCGTAAAGAAGCAAGCACACAAGGATTTGAAGAATTCCATTCTGAAATTTATGTTTTGAGTTTTGCCCACCATAGAAACATCGTCATGCTCTTAGGATA...

CDS

Download CDS FASTA

945 bp · TkA03G308660|TK1151|CDS

ATGTCAACAGAATTATATATCAAAGAGTCCATGAGATTTAGTTACTCAGAGATTCATCTTGCCACAAATTATCTTTCAAAAGAAAACCTGTTAGGTGAAGGAGGTTATGGTCTTGTTTACAAGGGTCAACTCGATGATGGCCAAATCAGAGCTGCTAAGGTGCGTAAAGAAGCAAGCACACAAGGATTTGAAGAATTCCATTCTGAAATTTATGTTTTGAGTTTTGCCCACCATAGAAACATCGTCATGCTCTTAGGATA...

Protein

Download Protein FASTA

314 aa · TkA03G308660|TK1151|PROTEIN

MSTELYIKESMRFSYSEIHLATNYLSKENLLGEGGYGLVYKGQLDDGQIRAAKVRKEASTQGFEEFHSEIYVLSFAHHRNIVMLLGYCCKENINILVYEYICNRSLEWHLFDEATKVLEWRQRHAIAIGTTKGLRFLHEDCRSSPIIHRDLRPSKILLTHDFVPMLGDFGLAKWKTNDSPIQTRILGTLGYLAPEYAENGMVSVRTDVYAYGITLIQIISERKVVTVDTKDHHESLIQWVEPLVERLALHDLIDPRLGDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G308660`
TK1151 ID	TkA03G308660
OH-1004 ID	LXL04_034032
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G308660

Location Chr03:75886227-75892793 (-)

Description Similar to CDG1: Serine/threonine-protein kinase CDG1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At1g23540`	Regulates the auxin-related MAX (More Axillary Growth) pathway during the shoot branching.	Over-expression of the IGI1 leading to altered shoot-branching development related to MAX pathway in Arabidopsis.2010 · DOI: 10.1007/s11103-010-9645-0
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At1g10620`	Putative proline-rich receptor-like protein kinase PERK11.	No verified direct reference in this release
`At3g26940`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034032 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0032502 developmental process Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23540

ath:AT1G70460

ath:AT3G26940

ath:AT5G38560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · TkA03G308660 · TK1151

Cell membrane0.456

Rank 2 · TkA03G308660 · TK1151

Nucleus0.272

Rank 3 · TkA03G308660 · TK1151

Golgi apparatus0.040

Rank 4 · TkA03G308660 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA03G308660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase27-292 aa

PF07714PK_Tyr_Ser-Thr27-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G308660	`PF00069`	Pkinase	27	292	2.8e-36	126.0
TkA03G308660	`PF07714`	PK_Tyr_Ser-Thr	27	293	1e-33	117.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAL8`	Arabidopsis thaliana	sp\|Q9CAL8\|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13	43.900%	Swiss-Prot	Medium
`Q9ZUE0`	Arabidopsis thaliana	sp\|Q9ZUE0\|PEK12_ARATH Proline-rich receptor-like protein kinase PERK12	42.800%	Swiss-Prot	Medium
`Q9FFW5`	Arabidopsis thaliana	sp\|Q9FFW5\|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8	42.100%	Swiss-Prot	Medium
`Q9SGY7`	Arabidopsis thaliana	sp\|Q9SGY7\|PEK11_ARATH Putative proline-rich receptor-like protein kinase PERK11	41.800%	Swiss-Prot	Medium
`Q9LSE1`	Arabidopsis thaliana	sp\|Q9LSE1\|CDG1_ARATH Serine/threonine-protein kinase CDG1	39.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card