TkA03G128680 | RubberDandelionOmics

Gene overview

TkA03G128680

Reference: TK1151 Chr: Chr03 Coordinates: 33021775-33022744 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

646 bp · TkA03G128680|TK1151|cDNA

GGACTTGACAATTCTGGGAAGACAACAATACTGTTGAAAATCAATGGTGAAGACACCAGTGTTATCAGCCCTACTCTTGGCTTCAACATCAAAACCATGACCTATGATAAGTATACCCTAAACATATGGGATGTTGGAGGTCAAAAGACTATACGGTCTTATTGGAGAAACTACTTTGAGCAGACTGATGGATTGGTATGGGTTGTAGACAGTTCGGATCTTAGAAGGCTGGATGACTGTAAATATGAGCTTGATAATCT...

CDS

Download CDS FASTA

492 bp · TkA03G128680|TK1151|CDS

GGACTTGACAATTCTGGGAAGACAACAATACTGTTGAAAATCAATGGTGAAGACACCAGTGTTATCAGCCCTACTCTTGGCTTCAACATCAAAACCATGACCTATGATAAGTATACCCTAAACATATGGGATGTTGGAGGTCAAAAGACTATACGGTCTTATTGGAGAAACTACTTTGAGCAGACTGATGGATTGGTATGGGTTGTAGACAGTTCGGATCTTAGAAGGCTGGATGACTGTAAATATGAGCTTGATAATCT...

Protein

Download Protein FASTA

163 aa · TkA03G128680|TK1151|PROTEIN

GLDNSGKTTILLKINGEDTSVISPTLGFNIKTMTYDKYTLNIWDVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKYELDNLLKEERLSGASLLVFANKQDIQGALSPNEIAKVLNLDAMDKTRHWRIVGCSAYTGEGLLEGFDWLVQDIASRIYVLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G128680`
TK1151 ID	TkA03G128680
OH-1004 ID	LXL04_002264
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 88.108 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G128680

Location Chr03:33021775-33022744 (+)

Description Similar to ARL2: ADP-ribosylation factor-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18390`	Has a role in the cofactor-dependent pathway of microtubule biogenesis.	The TITAN5 gene of Arabidopsis encodes a protein related to the ADP ribosylation factor family of GTP binding proteins.2000 · DOI: 10.1105/tpc.12.8.1379

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002264 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006457 protein folding Biological Process

GO:0007021 tubulin complex assembly Biological Process

GO:0007098 centrosome cycle Biological Process

GO:0009558 embryo sac cellularization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009960 endosperm development Biological Process

GO:0010811 positive regulation of cell-substrate adhesion Biological Process

GO:0015870 acetylcholine transport Biological Process

GO:0031113 regulation of microtubule polymerization Biological Process

GO:0031116 positive regulation of microtubule polymerization Biological Process

KEGG gene cross-reference

ath:AT2G18390

bta:511349

hsa:402

mmu:56327

rno:65142

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.500

Rank 1 · TkA03G128680 · TK1151

Golgi apparatus0.278

Rank 2 · TkA03G128680 · TK1151

Lysosome / Vacuole0.200

Rank 3 · TkA03G128680 · TK1151

Nucleus0.162

Rank 4 · TkA03G128680 · TK1151

Cell membrane0.119

Rank 5 · TkA03G128680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf1-155 aa

PF00503G-alpha1-14 aa

PF04670Gtr1_RagA1-107 aa

PF09439SRPRB1-121 aa

PF01926MMR_HSR11-103 aa

PF02421FeoB_N1-76 aa

PF08477Roc3-106 aa

PF00071Ras4-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G128680	`PF00025`	Arf	1	155	1.8e-62	210.6
TkA03G128680	`PF00503`	G-alpha	1	14	9.8e-08	32.2
TkA03G128680	`PF04670`	Gtr1_RagA	1	107	2.2e-06	28.0
TkA03G128680	`PF09439`	SRPRB	1	121	2.5e-06	27.7
TkA03G128680	`PF01926`	MMR_HSR1	1	103	0.00021	22.1
TkA03G128680	`PF02421`	FeoB_N	1	76	0.26	11.5
TkA03G128680	`PF08477`	Roc	3	106	1.6e-09	38.8
TkA03G128680	`PF00071`	Ras	4	155	2.3e-09	37.8
TkA03G128680	`PF00503`	G-alpha	23	106	9.8e-08	32.2
TkA03G128680	`PF00009`	GTP_EFTU	31	153	8.7e-05	22.9
TkA03G128680	`PF22155`	Mre11_acc_DNA_cap	31	92	0.01	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPX1`	Arabidopsis thaliana	sp\|Q9ZPX1\|ARF5_ARATH ADP-ribosylation factor-like protein 2	89.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card