TkA03G080100 | RubberDandelionOmics

Gene overview

TkA03G080100

Reference: TK1151 Chr: Chr03 Coordinates: 20434602-20437223 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1657 bp · TkA03G080100|TK1151|cDNA

GAAACAAACAAACACAGTCGTCTTTCTTATTTTCAAAATTGACCCCACCCACTTGCTTCCACACTTAGTTTTTCGGTTTTTCCAAACCTTTCTAGAACACCCCCTCCCCCCTCCCTCATCCGTGTTCTATAAAGCATCTTTCCAGTGTTTTCGTGCACGAATCCTTCAAATTCTTATAAATCAAACACGTTATTCGTTATCATCAGCATAGTCATCATTGTAAATTTGTAATCTGTTCGTGTTCTTGATTTCGCATAGTT...

CDS

Download CDS FASTA

879 bp · TkA03G080100|TK1151|CDS

ATGACGCATCGATCCGTTCCGGCGCCGTTTCTGACGAAGACGTATCTGTTGGTTGATGATCCGGCGACGAATGATGTTATTTCGTGGAACGAAACCGGCTCAACTTTCATAGTCTGGAAAACTGCTGATTTCGCTAGGGATTTGCTTCCAAATTCCTTCAAACACAATAATTTCTCCAGCTTCGTTCGTCAGCTTAATACTTATGGATTTCGTAAAACTGTTCCAGACAAATGGGAGTTCGCTAATGAGAACTTCAAGCG...

Protein

Download Protein FASTA

292 aa · TkA03G080100|TK1151|PROTEIN

MTHRSVPAPFLTKTYLLVDDPATNDVISWNETGSTFIVWKTADFARDLLPNSFKHNNFSSFVRQLNTYGFRKTVPDKWEFANENFKRGQRELLIEIRRRKTAPSSQAKPAGDGTPAPSPSSSGDDLGSSSTSSPDSKNPGSVDTPTVEKLENLSDENEKLKKEKQILTSELAQVKKQCDDLVAFLTQNVKVAPDYINRIMNINAVVGETATSTATVKVMDRDDSNDEERGECFKLFGVVLKEEKKKRVRDEVNISPGGKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G080100`
TK1151 ID	TkA03G080100
OH-1004 ID	LXL04_006847
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 96.575 / OH-1004 98.947 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G080100

Location Chr03:20434602-20437223 (+)

Description Similar to HSF24: Heat shock factor protein HSF24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36990`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release
`At1g46264`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0546800`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os09g0526600`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006847 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008356 asymmetric cell division Biological Process

GO:0009408 response to heat Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0080136 priming of cellular response to stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G46264

ath:AT4G36990

ath:AT5G62020

dosa:Os09g0456800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · TkA03G080100 · TK1151

Cytoplasm0.165

Rank 2 · TkA03G080100 · TK1151

Mitochondrion0.020

Rank 3 · TkA03G080100 · TK1151

Cell membrane0.018

Rank 4 · TkA03G080100 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA03G080100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447HSF_DNA-bind10-99 aa

PF04778LMP54-67 aa

PF16331TolA_bind_tri80-108 aa

PF02183HALZ82-97 aa

PF27978ZNF318_helical86-100 aa

PF29357B0252_5_C145-224 aa

PF06005ZapB146-181 aa

PF21924XRCC4_CC147-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G080100	`PF00447`	HSF_DNA-bind	10	99	3e-29	102.2
TkA03G080100	`PF04778`	LMP	54	67	0.013	16.2
TkA03G080100	`PF16331`	TolA_bind_tri	80	108	0.17	12.7
TkA03G080100	`PF02183`	HALZ	82	97	0.56	11.1
TkA03G080100	`PF27978`	ZNF318_helical	86	100	0.0096	17.0
TkA03G080100	`PF29357`	B0252_5_C	145	224	0.15	13.1
TkA03G080100	`PF06005`	ZapB	146	181	0.026	15.7
TkA03G080100	`PF21924`	XRCC4_CC	147	182	0.032	15.1
TkA03G080100	`PF16331`	TolA_bind_tri	147	181	0.17	12.7
TkA03G080100	`PF27978`	ZNF318_helical	148	182	0.0096	17.0
TkA03G080100	`PF04849`	HAP1_N	148	198	0.013	15.5
TkA03G080100	`PF04778`	LMP	148	210	0.013	16.2
TkA03G080100	`PF00170`	bZIP_1	149	181	5.1	8.0
TkA03G080100	`PF02183`	HALZ	151	176	0.56	11.1
TkA03G080100	`PF17253`	DUF5320	152	180	0.27	13.1
TkA03G080100	`PF07412`	Geminin	154	203	0.061	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96320`	Arabidopsis thaliana	sp\|Q96320\|HSFB1_ARATH Heat stress transcription factor B-1	51.200%	Swiss-Prot	High
`Q9C635`	Arabidopsis thaliana	sp\|Q9C635\|HSFB4_ARATH Heat stress transcription factor B-4	49.100%	Swiss-Prot	Medium
`Q6Z9C8`	Oryza sativa subsp. japonica	sp\|Q6Z9C8\|HFB2B_ORYSJ Heat stress transcription factor B-2b	49.300%	Swiss-Prot	Medium
`Q652B0`	Oryza sativa subsp. japonica	sp\|Q652B0\|HFB2C_ORYSJ Heat stress transcription factor B-2c	75.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card