TkA02G546130 | RubberDandelionOmics

Gene overview

TkA02G546130

Reference: TK1151 Chr: Chr02 Coordinates: 140873816-140874634 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · TkA02G546130|TK1151|cDNA

CCATACCTTACGCAAAGAGGTATTCGACAATTGTACCGCGTCCCTGTGGATACGATCCCTACTTCCATTATATTGCTCTATATTGTGAGTAGTTGTATTAGTGATTTATTTTACCCCTATTTATTTGTTGGATTCGACACCCAACACAGGCACCGTTCCGATTGGAAATCGGCTTATTTATTCTTCACCTGTGTTTCCAACTCAAGCGGATACTCCCCCGGAACAGGTTCGTACAACGAAATCCTCGACATTCTAGGCCG...

CDS

Download CDS FASTA

819 bp · TkA02G546130|TK1151|CDS

CCATACCTTACGCAAAGAGGTATTCGACAATTGTACCGCGTCCCTGTGGATACGATCCCTACTTCCATTATATTGCTCTATATTGTGAGTAGTTGTATTAGTGATTTATTTTACCCCTATTTATTTGTTGGATTCGACACCCAACACAGGCACCGTTCCGATTGGAAATCGGCTTATTTATTCTTCACCTGTGTTTCCAACTCAAGCGGATACTCCCCCGGAACAGGTTCGTACAACGAAATCCTCGACATTCTAGGCCG...

Protein

Download Protein FASTA

272 aa · TkA02G546130|TK1151|PROTEIN

PYLTQRGIRQLYRVPVDTIPTSIILLYIVSSCISDLFYPYLFVGFDTQHRHRSDWKSAYLFFTCVSNSSGYSPGTGSYNEILDILGRFKRLTEVSQPLDEMSNKNNNLINERTYGIIVNKYAAAHKIEDAIDFFYKRKQFGLKLDLIAFQTLLLSLCRYKHVEAAKFLFHSKKHEFHHTIKTMNIILNGWCILGSLHESKRFWNNIVSPKHKPDKFTYSIFINPLTKSGKITTAVNLSQAMWEKLKKGAPLMSPYATPSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G546130`
TK1151 ID	TkA02G546130
OH-1004 ID	LXL04_039545
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.300
Protein coverage (%)	TK1151 71.691 / OH-1004 36.792 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G546130

Location Chr02:140873816-140874634 (-)

Description Similar to At3g15200: Putative pentatricopeptide repeat-containing protein At3g15200

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15200`	Putative pentatricopeptide repeat-containing protein At3g15200.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039545 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G80550

ath:AT3G15200

ath:AT3G62470

ath:AT5G15010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.744

Rank 1 · TkA02G546130 · TK1151

Plastid0.133

Rank 2 · TkA02G546130 · TK1151

Cytoplasm0.057

Rank 3 · TkA02G546130 · TK1151

Nucleus0.049

Rank 4 · TkA02G546130 · TK1151

Cell membrane0.015

Rank 5 · TkA02G546130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12854PPR_170-101 aa

PF13041PPR_273-122 aa

PF29070MSC6_N77-234 aa

PF01535PPR77-103 aa

PF12854PPR_1110-134 aa

PF13041PPR_2111-158 aa

PF01535PPR113-136 aa

PF15571Imm44115-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G546130	`PF12854`	PPR_1	70	101	1.6e-11	44.4
TkA02G546130	`PF13041`	PPR_2	73	122	4.2e-18	65.9
TkA02G546130	`PF29070`	MSC6_N	77	234	4.9e-10	39.8
TkA02G546130	`PF01535`	PPR	77	103	1e-05	26.1
TkA02G546130	`PF12854`	PPR_1	110	134	1.6e-11	44.4
TkA02G546130	`PF13041`	PPR_2	111	158	4.2e-18	65.9
TkA02G546130	`PF01535`	PPR	113	136	1e-05	26.1
TkA02G546130	`PF15571`	Imm44	115	180	0.67	10.7
TkA02G546130	`PF12854`	PPR_1	141	169	1.6e-11	44.4
TkA02G546130	`PF01535`	PPR	149	170	1e-05	26.1
TkA02G546130	`PF13041`	PPR_2	180	225	4.2e-18	65.9
TkA02G546130	`PF01535`	PPR	182	205	1e-05	26.1
TkA02G546130	`PF12854`	PPR_1	184	204	1.6e-11	44.4
TkA02G546130	`PF27115`	Cho_C	186	230	0.097	13.2
TkA02G546130	`PF15571`	Imm44	207	224	0.67	10.7
TkA02G546130	`PF12854`	PPR_1	211	237	1.6e-11	44.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIL5`	Arabidopsis thaliana	sp\|Q9LIL5\|PP233_ARATH Putative pentatricopeptide repeat-containing protein At3g15200	50.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card