TkA02G319840 | RubberDandelionOmics

Gene overview

TkA02G319840

Reference: TK1151 Chr: Chr02 Coordinates: 81246715-81247710 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

966 bp · TkA02G319840|TK1151|cDNA

ATGGATCAAGAACAAGAAGAAATTCAATTTCTTGGCTTTCTCGGCATCTTCAAAGAATCCTTCAAAATCATCTCAACTTACAAAGAAATCTTCACAAAAATCACCCTCTCCATCATCCTCCCTCTCTCCTTCATCTTCTTGGCTCACATCGAAGTCTCCGAATACCTCTTTGGCAAAATCATAAGCGATGAATCCGATCTTGATCAAACCCCACAAAACACCAGAAAGTATAGTAAACTGTCCGATGTTATCTCTTTTGC...

CDS

Download CDS FASTA

966 bp · TkA02G319840|TK1151|CDS

ATGGATCAAGAACAAGAAGAAATTCAATTTCTTGGCTTTCTCGGCATCTTCAAAGAATCCTTCAAAATCATCTCAACTTACAAAGAAATCTTCACAAAAATCACCCTCTCCATCATCCTCCCTCTCTCCTTCATCTTCTTGGCTCACATCGAAGTCTCCGAATACCTCTTTGGCAAAATCATAAGCGATGAATCCGATCTTGATCAAACCCCACAAAACACCAGAAAGTATAGTAAACTGTCCGATGTTATCTCTTTTGC...

Protein

Download Protein FASTA

321 aa · TkA02G319840|TK1151|PROTEIN

MDQEQEEIQFLGFLGIFKESFKIISTYKEIFTKITLSIILPLSFIFLAHIEVSEYLFGKIISDESDLDQTPQNTRKYSKLSDVISFAYFIFFLILSLLSTSAIVYTIACIYTSKHMTFKKVMSVVPKVWKRLMVTFVWNFIIIFALNLLALVVFLCWIASAGFTNTGIFTISILGIVYLVVFIYISVVWHLASVVSVLEDDYGIRAMLKSKDLIKGKTGVSMAIFCVLNLCFITIQVGFETHVVIGENSVVVRTIYAVLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G319840`
TK1151 ID	TkA02G319840
OH-1004 ID	LXL04_015531
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 50.845 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G319840`
Location	Chr02:81246715-81247710 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015531` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.455

Rank 1 · TkA02G319840 · TK1151

Lysosome / Vacuole0.284

Rank 2 · TkA02G319840 · TK1151

Endoplasmic reticulum0.193

Rank 3 · TkA02G319840 · TK1151

Cytoplasm0.086

Rank 4 · TkA02G319840 · TK1151

Golgi apparatus0.063

Rank 5 · TkA02G319840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29520DUF85581-318 aa

PF31016Lunapark_N56-98 aa

PF00487FA_desaturase89-200 aa

PF31016Lunapark_N162-168 aa

PF31016Lunapark_N250-269 aa

PF00487FA_desaturase256-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G319840	`PF29520`	DUF8558	1	318	3.5e-135	451.3
TkA02G319840	`PF31016`	Lunapark_N	56	98	0.99	10.2
TkA02G319840	`PF00487`	FA_desaturase	89	200	0.21	12.0
TkA02G319840	`PF31016`	Lunapark_N	162	168	0.99	10.2
TkA02G319840	`PF31016`	Lunapark_N	250	269	0.99	10.2
TkA02G319840	`PF00487`	FA_desaturase	256	272	0.21	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card