TkA01G611290 | RubberDandelionOmics

Gene overview

TkA01G611290

Reference: TK1151 Chr: Chr01 Coordinates: 154132864-154134695 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1135 bp · TkA01G611290|TK1151|cDNA

TCAAGAAAACAGAGACCGTTTTTCCCGCGAACCAAAGAAAATCTTTCTTTTGATCTTCTGTCTTTCCCGAACCGGCGAGAGTGAGGAGGAGAGAGAAATCCCGAAAATCCAAATCAAAAACACCCATCGAATTCACCTTCATCGTCTCCTCCCGTCAACGCTTGATTCATATCTTTTCATTCTTTTGTTTGAATCCCGATACTATTTGGTCATCGGTTGGCGCAAATTCTTGATTTTGAGGAACTCTTATTTTCGGTAAA...

CDS

Download CDS FASTA

591 bp · TkA01G611290|TK1151|CDS

ATGACAGATAATTTTGGCACGAAATCTTTAGTGGGTGAAGGTTCTTATGGGAGGGTTTTCCATGGTAAATTAAGTACAGGTGAAGAAGCTGCAGTAAAAAAACTGGATACCAGTTCTTCACCTGAGCCCGATAATGATTTTACATCCCAGTTATCACTCGTTTCAAGGCTTAAAAACGAGTATTTTGTGCAATTAATCGGTTATTGTTTGGAGGGAAACAACCGAATCTTGATTTATCAGTATGCAACCATGGGTTCTTT...

Protein

Download Protein FASTA

196 aa · TkA01G611290|TK1151|PROTEIN

MTDNFGTKSLVGEGSYGRVFHGKLSTGEEAAVKKLDTSSSPEPDNDFTSQLSLVSRLKNEYFVQLIGYCLEGNNRILIYQYATMGSLHDVLHGRKGVQNAEPGPILTWIQRVRIAYGAARAKIADFNLSNQSSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSNS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G611290`
TK1151 ID	TkA01G611290
OH-1004 ID	LXL04_000441
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.200
Protein coverage (%)	TK1151 98.980 / OH-1004 61.202 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G611290

Location Chr01:154132864-154134695 (-)

Description Similar to At2g41970: Probable protein kinase At2g41970

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41970`	May phosphorylate ABA receptors and participate in ABA signaling during dehydration.	Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At3g59350`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYL8/RCAR3, PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	No verified direct reference in this release
`At2g43230`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	CARK6 is involved in abscisic acid to regulate stress responses in Arabidopsis thaliana.2019 · DOI: 10.1016/j.bbrc.2019.03.180 Catalytically inactive subgroup VIII receptor-like cytoplasmic kinases regulate the immune-triggered oxidative burst in Arabidopsis thaliana.2025 · DOI: 10.1093/jxb/erae486
`At1g06700`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	Catalytically inactive subgroup VIII receptor-like cytoplasmic kinases regulate the immune-triggered oxidative burst in Arabidopsis thaliana.2025 · DOI: 10.1093/jxb/erae486

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000441 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:1901653 cellular response to peptide Biological Process

GO:2000037 regulation of stomatal complex patterning Biological Process

GO:2000038 regulation of stomatal complex development Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

KEGG gene cross-reference

ath:AT1G06700

ath:AT2G41970

ath:AT3G59350

sly:544006

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.529

Rank 1 · TkA01G611290 · TK1151

Cytoplasm0.380

Rank 2 · TkA01G611290 · TK1151

Nucleus0.229

Rank 3 · TkA01G611290 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA01G611290 · TK1151

Golgi apparatus0.035

Rank 5 · TkA01G611290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase7-101 aa

PF07714PK_Tyr_Ser-Thr9-103 aa

PF07714PK_Tyr_Ser-Thr120-187 aa

PF00069Pkinase120-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G611290	`PF00069`	Pkinase	7	101	3.1e-25	89.8
TkA01G611290	`PF07714`	PK_Tyr_Ser-Thr	9	103	4.1e-28	99.1
TkA01G611290	`PF07714`	PK_Tyr_Ser-Thr	120	187	4.1e-28	99.1
TkA01G611290	`PF00069`	Pkinase	120	189	3.1e-25	89.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93749`	Arabidopsis thaliana	sp\|P93749\|CARK4_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 4	71.900%	Swiss-Prot	High
`B9DFG5`	Arabidopsis thaliana	sp\|B9DFG5\|CARK5_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 5	65.900%	Swiss-Prot	High
`Q9ZW72`	Arabidopsis thaliana	sp\|Q9ZW72\|CARK6_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 6	63.700%	Swiss-Prot	High
`Q8H1G6`	Arabidopsis thaliana	sp\|Q8H1G6\|CARK7_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 7	63.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card