TkA01G601890 | RubberDandelionOmics

Gene overview

TkA01G601890

Reference: TK1151 Chr: Chr01 Coordinates: 151571167-151573793 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1458 bp · TkA01G601890|TK1151|cDNA

TACGACATCGTATCAGGTATAATAAATTACATTAGTGCCATCCGGACACCCTAAGCTCTCCTCCATAAGTACTCCCAACACCCATTGCCATTTCTCCTCACCCCCATAACCACCGTCAATCTCTCTCATTGCCTTCTCTCGTGTAGTTTAGCCCTAAATGGCGGTCGTCTCCAGCATTGTGTTCATCATTTTCTCGGCGTTGTCGGTCGCCGAGTGCAGAATTCAGGGAAACTACGCCGGCGGTGCTTGGGAAGGAGCTC...

CDS

Download CDS FASTA

735 bp · TkA01G601890|TK1151|CDS

ATGGCGGTCGTCTCCAGCATTGTGTTCATCATTTTCTCGGCGTTGTCGGTCGCCGAGTGCAGAATTCAGGGAAACTACGCCGGCGGTGCTTGGGAAGGAGCTCATGCTACCTTCTACGGTGGAAGCGACGCCTCCGGTACCATGGGAGGTGCTTGTGGTTACGGCAATCTTTACAGCCAAGGATACGGAGTCAACACTGCAGCTCTTAGCACCGCCCTCTTCAACAACGGTCTAAGCTGCGGCGCATGCTTTGAAATCAA...

Protein

Download Protein FASTA

244 aa · TkA01G601890|TK1151|PROTEIN

MAVVSSIVFIIFSALSVAECRIQGNYAGGAWEGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSIFVTGTNFCPPNYGTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKAGGIRFTVNGFRYFNLVLISNVAGAGDIQKVWVKGTKTNWMSMSRNWGQNWQSNAVLTGQPLSFRVTASDRRTSTSWNIAPANWQFGQTFTGKNFRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G601890`
TK1151 ID	TkA01G601890
OH-1004 ID	LXL04_000587
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G601890

Location Chr01:151571167-151573793 (+)

Description Similar to EXPA4: Expansin-A4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28950`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At2g39700`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At2g37640`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At3g55500`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0822000`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000587 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006949 syncytium formation Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0010114 response to red light Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G28950

ath:AT2G37640

ath:AT2G39700

ath:AT3G55500

dosa:Os03g0822000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.872

Rank 1 · TkA01G601890 · TK1151

Cytoplasm0.046

Rank 2 · TkA01G601890 · TK1151

Lysosome / Vacuole0.025

Rank 3 · TkA01G601890 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA01G601890 · TK1151

Plastid0.015

Rank 5 · TkA01G601890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22514EXPB1_D136-113 aa

PF29515Expansin_N45-88 aa

PF03330DPBB_166-140 aa

PF01357Expansin_C151-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G601890	`PF22514`	EXPB1_D1	36	113	2.1e-07	32.1
TkA01G601890	`PF29515`	Expansin_N	45	88	5e-08	33.9
TkA01G601890	`PF03330`	DPBB_1	66	140	1.9e-21	76.8
TkA01G601890	`PF01357`	Expansin_C	151	228	4.6e-31	107.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38865`	Arabidopsis thaliana	sp\|Q38865\|EXPA6_ARATH Expansin-A6	75.100%	Swiss-Prot	High
`O48818`	Arabidopsis thaliana	sp\|O48818\|EXPA4_ARATH Expansin-A4	75.100%	Swiss-Prot	High
`O80932`	Arabidopsis thaliana	sp\|O80932\|EXPA3_ARATH Expansin-A3	78.600%	Swiss-Prot	High
`Q9M2S9`	Arabidopsis thaliana	sp\|Q9M2S9\|EXP16_ARATH Expansin-A16	74.000%	Swiss-Prot	High
`Q852A1`	Oryza sativa subsp. japonica	sp\|Q852A1\|EXPA7_ORYSJ Expansin-A7	76.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card