TkA01G421150 | RubberDandelionOmics

Gene overview

TkA01G421150

Reference: TK1151 Chr: Chr01 Coordinates: 105192331-105193723 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA01G421150|TK1151|cDNA

ATGAGTGTGAGTGCAAATGGGCAAGGTCGAATATTTAACAAATCCAGTACAAGTGCATTGGTAGCCCAAGGTTTAAACGTGGTTGCTCTTCATGGTGGCCGAACTCAGATCGAAAGAGAGGGTGCCCTCCGTGACTTCAGACATGGTCCCACTAACATCTTGGTTGCTACTGATGTTGCCTCTCGTGGTCTGTACGTTACCGGTGTTGCTCATGTAGTCAACCTTGACCTTCCAAAGGTGGGCATATCTTCTGGAGCAAC...

CDS

Download CDS FASTA

504 bp · TkA01G421150|TK1151|CDS

ATGAGTGTGAGTGCAAATGGGCAAGGTCGAATATTTAACAAATCCAGTACAAGTGCATTGGTAGCCCAAGGTTTAAACGTGGTTGCTCTTCATGGTGGCCGAACTCAGATCGAAAGAGAGGGTGCCCTCCGTGACTTCAGACATGGTCCCACTAACATCTTGGTTGCTACTGATGTTGCCTCTCGTGGTCTGTACGTTACCGGTGTTGCTCATGTAGTCAACCTTGACCTTCCAAAGGTGGGCATATCTTCTGGAGCAAC...

Protein

Download Protein FASTA

167 aa · TkA01G421150|TK1151|PROTEIN

MSVSANGQGRIFNKSSTSALVAQGLNVVALHGGRTQIEREGALRDFRHGPTNILVATDVASRGLYVTGVAHVVNLDLPKVGISSGATAAAAIKVGKRHENAGKLIAVVFPSFGERYLSTILFPWLSGHHKKKLKEEFVAWSIEEHFGVVVFIPAGCPFQVSFRFLFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G421150`
TK1151 ID	TkA01G421150
OH-1004 ID	LXL04_002778
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	70.900
Protein coverage (%)	TK1151 100.000 / OH-1004 70.606 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G421150

Location Chr01:105192331-105193723 (+)

Description Similar to Cysteine synthase, chloroplastic/chromoplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59760`	Acts as a cysteine synthase.	No verified direct reference in this release
`At2g43750`	Acts as a major cysteine synthase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0602400`	DEAD-box ATP-dependent RNA helicase 52A.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002778 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0000390 spliceosomal complex disassembly Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006369 termination of RNA polymerase II transcription Biological Process

GO:0006535 L-cysteine biosynthetic process from L-serine Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0071042 nuclear polyadenylation-dependent mRNA catabolic process Biological Process

GO:1901195 positive regulation of formation of translation preinitiation complex Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009509 chromoplast Cellular Component

KEGG gene cross-reference

ago:AGOS_ADL273C

dha:DEHA2A12958g

dosa:Os06g0602400

pgu:PGUG_04031

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.445

Rank 1 · TkA01G421150 · TK1151

Nucleus0.271

Rank 2 · TkA01G421150 · TK1151

Mitochondrion0.176

Rank 3 · TkA01G421150 · TK1151

Peroxisome0.092

Rank 4 · TkA01G421150 · TK1151

Endoplasmic reticulum0.090

Rank 5 · TkA01G421150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00271Helicase_C21-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G421150	`PF00271`	Helicase_C	21	79	2.5e-15	57.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q43725`	Arabidopsis thaliana	sp\|Q43725\|CYSKM_ARATH Cysteine synthase, mitochondrial	90.700%	Swiss-Prot	Low
`P47999`	Arabidopsis thaliana	sp\|P47999\|CYSKP_ARATH Cysteine synthase, chloroplastic/chromoplastic	88.400%	Swiss-Prot	Low
`Q0DB53`	Oryza sativa subsp. japonica	sp\|Q0DB53\|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A	63.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card