TkA01G387040 | RubberDandelionOmics

Gene overview

TkA01G387040

Reference: TK1151 Chr: Chr01 Coordinates: 96583185-96586384 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1956 bp · TkA01G387040|TK1151|cDNA

AATGCTCTTTCTCACATGATTTCATTTCCACTGCGTTCAATTTCAATCCCAATACCCTCTTCTTCTTCTTTCACGGGTCGATTTGCTTTCTTTTCTCTTTTTAATTTTCATGAGTGCTACTTTACTCATCCACCAAGCAAAGAAGAAAACCCAATGATGCAACTCCCCAAATCCTCCTTTGATTAATGTGCTATTGCTTCCATACCAAATCACCTCTCTGCTCCTTTTCATCTCCCTCTAAAACCCCAATCTTTACCAAA...

CDS

Download CDS FASTA

747 bp · TkA01G387040|TK1151|CDS

ATGGTGAAGAACCCATCGCATCAAGACCTCGATTCACCAACTTACATGGCTACATTGAAGAAATTTAAGCCGTTTAAACTTTTCGAACCCTCATTGGGCATACTGGGTTTTTTGTTCGTTACAGTTTGTATAATTTTTGGGTTTATTTATTTGGATTACAGAAATGTAGTTACAGGCGGTGTATTTCGATTTTCGAATGGGATAGAGAGGCTTAAGTGGTTAAAGTTCGGAGGTAGCAGTGAAGTTTATAGTAGAAAAAG...

Protein

Download Protein FASTA

248 aa · TkA01G387040|TK1151|PROTEIN

MVKNPSHQDLDSPTYMATLKKFKPFKLFEPSLGILGFLFVTVCIIFGFIYLDYRNVVTGGVFRFSNGIERLKWLKFGGSSEVYSRKRVDFLSVDGDGCDVFEGDWLWDEKYPLYESKDCRFLDEGFRCSENGRPDFLFTKWRWQPKDCNLPRFNGTRMLESMRNKRIVFVGDSIGRNQWESLLCMMSSSITSTNKNNNDSIYEVNGNPITKHKGFLVFKFRDYNCTLEYYRAPFLVLQSRPPPDSPSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G387040`
TK1151 ID	TkA01G387040
OH-1004 ID	LXL04_003188
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 54.148 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G387040

Location Chr01:96583185-96586384 (-)

Description Similar to TBL11: Protein trichome birefringence-like 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19160`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g06080`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g11570`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g06230`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g62390`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003188 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G06080

ath:AT3G11570

ath:AT3G62390

ath:AT5G06230

ath:AT5G19160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.670

Rank 1 · TkA01G387040 · TK1151

Endoplasmic reticulum0.100

Rank 2 · TkA01G387040 · TK1151

Cell membrane0.064

Rank 3 · TkA01G387040 · TK1151

Extracellular0.037

Rank 4 · TkA01G387040 · TK1151

Nucleus0.036

Rank 5 · TkA01G387040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416PMR5N97-149 aa

PF30617DUF8671103-110 aa

PF30617DUF8671130-156 aa

PF24536NXPE4_C143-199 aa

PF13839PC-Esterase150-244 aa

PF30617DUF8671194-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G387040	`PF14416`	PMR5N	97	149	1.2e-21	77.5
TkA01G387040	`PF30617`	DUF8671	103	110	0.59	10.7
TkA01G387040	`PF30617`	DUF8671	130	156	0.59	10.7
TkA01G387040	`PF24536`	NXPE4_C	143	199	0.00046	20.6
TkA01G387040	`PF13839`	PC-Esterase	150	244	1e-29	105.1
TkA01G387040	`PF30617`	DUF8671	194	224	0.59	10.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5BPJ0`	Arabidopsis thaliana	sp\|Q5BPJ0\|TBL11_ARATH Protein trichome birefringence-like 11	59.600%	Swiss-Prot	High
`Q9LDG2`	Arabidopsis thaliana	sp\|Q9LDG2\|TBL10_ARATH Protein trichome birefringence-like 10	61.000%	Swiss-Prot	High
`Q9CAX1`	Arabidopsis thaliana	sp\|Q9CAX1\|TBL8_ARATH Protein trichome birefringence-like 8	57.100%	Swiss-Prot	Medium
`Q9FFZ4`	Arabidopsis thaliana	sp\|Q9FFZ4\|TBL9_ARATH Protein trichome birefringence-like 9	54.100%	Swiss-Prot	Medium
`Q9LZQ1`	Arabidopsis thaliana	sp\|Q9LZQ1\|TBL6_ARATH Protein trichome birefringence-like 6	50.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card