TkA01G385420 | RubberDandelionOmics

Gene overview

TkA01G385420

Reference: TK1151 Chr: Chr01 Coordinates: 96194864-96197400 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1506 bp · TkA01G385420|TK1151|cDNA

CTCCTTGACGCGAGGCTGTGAGCCTCTAAATCTACGAATGTTCCTACTTATATCTCATTCTCAATATGATTTTTCTGAATGTTCAACTATATATTCTGATTTCTTTGCTGATTTTTTATAATAAAATCAGTCGAATGTATGTTCTCATACTTATATCTACACCACCGACCACGATTCCAGACCTTCTTGTGATTCTGACATCTCTCGCCAACAAACACTCACAAGGGCATGATGAAATCCGAACGACAAAAAACATCGAA...

CDS

Download CDS FASTA

1029 bp · TkA01G385420|TK1151|CDS

ATGATGAAATCCGAACGACAAAAAACATCGAAACTGGAAGATGGGTTCGATTTGATCGGTAGCATGCCGGATGCTATTCTTATTTTGATTCTCTCACGTCTTTCATCCACTGAAGAACAAATCAGAAGCAGCATTTTGTCCCAACGCTGGAGGTATCTTTGGACTACAATTCCCTCATTATGCTTGCAATTTGTATCCAGAAAAAAAATAAATAGAAAAAGCGAATTTAAAGAGTTTACGTATTGGGTTTTAGCAAGCAA...

Protein

Download Protein FASTA

342 aa · TkA01G385420|TK1151|PROTEIN

MMKSERQKTSKLEDGFDLIGSMPDAILILILSRLSSTEEQIRSSILSQRWRYLWTTIPSLCLQFVSRKKINRKSEFKEFTYWVLASKTVDLDSFRLRLNNDYSMSTIWRWVHLAVMRNVKQLDLSFRIKEETEAIDLPRYLVNCDSLEVLRLDLMNSNLSLPRFPGFSALKVLDLTEADLPEDDDWVNNFLKSCPLLEDLSLVGCFIGELVCISSPKLKRLRIINWDDVGCHGIKISCPNLADLKLGGRVLYGDSDSVVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G385420`
TK1151 ID	TkA01G385420
OH-1004 ID	LXL04_003226
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	71.800
Protein coverage (%)	TK1151 99.415 / OH-1004 32.106 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G385420

Location Chr01:96194864-96197400 (-)

Description Similar to At3g52680: F-box/FBD/LRR-repeat protein At3g52680

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22700`	F-box/FBD/LRR-repeat protein At5g22700.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At5g56390`	Putative FBD-associated F-box protein At5g56390.	No verified direct reference in this release
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003226 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G52680

ath:AT5G56560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.885

Rank 1 · TkA01G385420 · TK1151

Cytoplasm0.157

Rank 2 · TkA01G385420 · TK1151

Cell membrane0.036

Rank 3 · TkA01G385420 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA01G385420 · TK1151

Plastid0.016

Rank 5 · TkA01G385420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like20-53 aa

PF00646F-box21-58 aa

PF23622LRR_At1g61320_AtMIF187-323 aa

PF24758LRR_At5g56370109-254 aa

PF29594LRR_SKP2118-153 aa

PF12799LRR_4118-158 aa

PF12799LRR_4147-177 aa

PF29594LRR_SKP2148-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G385420	`PF12937`	F-box-like	20	53	0.01	16.3
TkA01G385420	`PF00646`	F-box	21	58	0.00016	22.2
TkA01G385420	`PF23622`	LRR_At1g61320_AtMIF1	87	323	4.4e-10	40.2
TkA01G385420	`PF24758`	LRR_At5g56370	109	254	8.5e-19	68.8
TkA01G385420	`PF29594`	LRR_SKP2	118	153	0.0054	16.7
TkA01G385420	`PF12799`	LRR_4	118	158	0.0086	17.0
TkA01G385420	`PF12799`	LRR_4	147	177	0.0086	17.0
TkA01G385420	`PF29594`	LRR_SKP2	148	321	0.0054	16.7
TkA01G385420	`PF12799`	LRR_4	190	208	0.0086	17.0
TkA01G385420	`PF12799`	LRR_4	197	223	0.0086	17.0
TkA01G385420	`PF24758`	LRR_At5g56370	274	323	8.5e-19	68.8
TkA01G385420	`PF12799`	LRR_4	276	293	0.0086	17.0
TkA01G385420	`PF00646`	F-box	306	315	0.00016	22.2
TkA01G385420	`PF12937`	F-box-like	306	313	0.01	16.3
TkA01G385420	`PF12799`	LRR_4	308	321	0.0086	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNJ1`	Arabidopsis thaliana	sp\|Q9FNJ1\|FDL47_ARATH F-box/FBD/LRR-repeat protein At5g22700	31.800%	Swiss-Prot	Medium
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	30.400%	Swiss-Prot	Medium
`Q9FM92`	Arabidopsis thaliana	sp\|Q9FM92\|FBD22_ARATH Putative FBD-associated F-box protein At5g56390	27.500%	Swiss-Prot	Low
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	26.400%	Swiss-Prot	Low
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	31.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card