TkA01G109940 | RubberDandelionOmics

Gene overview

TkA01G109940

Reference: TK1151 Chr: Chr01 Coordinates: 27925271-27926839 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1441 bp · TkA01G109940|TK1151|cDNA

AAAAATATAAGAGGAAAATCAGAAAAAAATAAACAATTGCTCTTCCATATATTTCAAATCCTGCCATCTATAAATTACGTTCTCCATTCGCTTGTAACACACAAACGCACTATGGACGCTTTGCCAAACAGATTAGAAGGCAAAGTAGCCATAGTCACCGGCGGTGCTAGTGGCATCGGTGAAAGCACGGTGAGGCTGTTCGTTAAATATGGCGCCAAAGTCGTGATAGCAGACGTACAAGATGATTTGGGACTTTCTCT...

CDS

Download CDS FASTA

951 bp · TkA01G109940|TK1151|CDS

AAAAATATAAGAGGAAAATCAGAAAAAAATAAACAATTGCTCTTCCATATATTTCAAATCCTGCCATCTATAAATTACGTTCTCCATTCGCTTGTAACACACAAACGCACTATGGACGCTTTGCCAAACAGATTAGAAGGCAAAGTAGCCATAGTCACCGGCGGTGCTAGTGGCATCGGTGAAAGCACGGTGAGGCTGTTCGTTAAATATGGCGCCAAAGTCGTGATAGCAGACGTACAAGATGATTTGGGACTTTCTCT...

Protein

Download Protein FASTA

316 aa · TkA01G109940|TK1151|PROTEIN

KNIRGKSEKNKQLLFHIFQILPSINYVLHSLVTHKRTMDALPNRLEGKVAIVTGGASGIGESTVRLFVKYGAKVVIADVQDDLGLSLCNDLASKSGENVIYVHCDVTQESDVENAVDTAVSKFGKLDIMFNNAGIPGNLDFKILESDNENFKRVFDVNAFGSFLGAKHAARVMIPAKRGAILFTSSSASVVAGESPHAYTVSKHAVVGLMKNLCVELGQHGIRVNCISPGSVSTPLLTNAMGLGKAAVDDILCAAAVLKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G109940`
TK1151 ID	TkA01G109940
OH-1004 ID	LXL04_004801
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 96.203 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G109940

Location Chr01:27925271-27926839 (-)

Description Similar to Secoisolariciresinol dehydrogenase (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0179200`	Involved in momilactone phytoalexins biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004801 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009411 response to UV Biological Process

GO:0009611 response to wounding Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009807 lignan biosynthetic process Biological Process

GO:0016099 monoterpenoid biosynthetic process Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0044283 small molecule biosynthetic process Biological Process

GO:0051289 protein homotetramerization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004022 alcohol dehydrogenase (NAD+) activity Molecular Function

KEGG gene cross-reference

ag:AAK38664

ag:ABN14311

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.679

Rank 1 · TkA01G109940 · TK1151

Nucleus0.278

Rank 2 · TkA01G109940 · TK1151

Peroxisome0.148

Rank 3 · TkA01G109940 · TK1151

Mitochondrion0.080

Rank 4 · TkA01G109940 · TK1151

Plastid0.043

Rank 5 · TkA01G109940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03193RsgA_GTPase20-81 aa

PF23441SDR43-293 aa

PF00106adh_short48-239 aa

PF08659KR50-211 aa

PF010733Beta_HSD51-118 aa

PF01370Epimerase51-118 aa

PF13561adh_short_C256-295 aa

PF13649Methyltransf_2557-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G109940	`PF03193`	RsgA_GTPase	20	81	0.11	13.0
TkA01G109940	`PF23441`	SDR	43	293	5.4e-11	43.1
TkA01G109940	`PF00106`	adh_short	48	239	6.8e-54	183.0
TkA01G109940	`PF08659`	KR	50	211	1e-10	42.6
TkA01G109940	`PF01073`	3Beta_HSD	51	118	0.00036	20.4
TkA01G109940	`PF01370`	Epimerase	51	118	0.084	13.0
TkA01G109940	`PF13561`	adh_short_C2	56	295	1e-65	222.3
TkA01G109940	`PF13649`	Methyltransf_25	57	127	0.1	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7FAE1`	Oryza sativa subsp. japonica	sp\|Q7FAE1\|MOMAS_ORYSJ Momilactone A synthase	55.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card