TkA01G066780 | RubberDandelionOmics

Gene overview

TkA01G066780

Reference: TK1151 Chr: Chr01 Coordinates: 17036221-17038668 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · TkA01G066780|TK1151|cDNA

ATGATGAATTCATTACCTACTATTTCTACTGTCCACTCTCTTTTAATCCATGAAGAAAGACAAAGAGACATCACTTCCAATCCAAATCTGGTTGTTGAAGCTATGGCTATGAATGTCAATAGTGCATCTCGAAAGAACATACTATGCTCTCACTGCAAGAAGACTGGTCACATTAAAGCTCAATGTTACAGATTACATGGTTTCCCATCCGATTATAAATTCACCAAATCTAAGAAAGCTGATCAGACTTCATCTGTCAA...

CDS

Download CDS FASTA

1143 bp · TkA01G066780|TK1151|CDS

ATGATGAATTCATTACCTACTATTTCTACTGTCCACTCTCTTTTAATCCATGAAGAAAGACAAAGAGACATCACTTCCAATCCAAATCTGGTTGTTGAAGCTATGGCTATGAATGTCAATAGTGCATCTCGAAAGAACATACTATGCTCTCACTGCAAGAAGACTGGTCACATTAAAGCTCAATGTTACAGATTACATGGTTTCCCATCCGATTATAAATTCACCAAATCTAAGAAAGCTGATCAGACTTCATCTGTCAA...

Protein

Download Protein FASTA

380 aa · TkA01G066780|TK1151|PROTEIN

MMNSLPTISTVHSLLIHEERQRDITSNPNLVVEAMAMNVNSASRKNILCSHCKKTGHIKAQCYRLHGFPSDYKFTKSKKADQTSSVNNVADSTPVNNTISPEQYQNLMQLLNNSSINNSSTTVNSVITNGAMDSAGNHLDSSDKHVSYIFNVSDNSSCETSWIIDSGASDHICCNKELYSSMLNFSQQHQVNLPNGQTIPVSKYGEVPIHETINLQEVLYVPDFRHNLIYVNAEYRGQTDDDSGGGILIDGDGDGGNHTA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G066780`
TK1151 ID	TkA01G066780
OH-1004 ID	LXL04_001528
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.100
Protein coverage (%)	TK1151 37.105 / OH-1004 47.869 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G066780`
Location	Chr01:17036221-17038668 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001528` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.606

Rank 1 · TkA01G066780 · TK1151

Nucleus0.424

Rank 2 · TkA01G066780 · TK1151

Mitochondrion0.061

Rank 3 · TkA01G066780 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA01G066780 · TK1151

Cell membrane0.045

Rank 5 · TkA01G066780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30572DUF863940-56 aa

PF16588zf-C2H2_1046-63 aa

PF00098zf-CCHC49-62 aa

PF29482CG4951_C73-132 aa

PF22421SYY_C-terminal100-147 aa

PF30572DUF8639112-120 aa

PF22936Pol_BBD162-232 aa

PF30572DUF8639166-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G066780	`PF30572`	DUF8639	40	56	7.9	7.2
TkA01G066780	`PF16588`	zf-C2H2_10	46	63	0.00049	20.5
TkA01G066780	`PF00098`	zf-CCHC	49	62	0.037	14.8
TkA01G066780	`PF29482`	CG4951_C	73	132	0.17	12.9
TkA01G066780	`PF22421`	SYY_C-terminal	100	147	0.12	12.9
TkA01G066780	`PF30572`	DUF8639	112	120	7.9	7.2
TkA01G066780	`PF22936`	Pol_BBD	162	232	3.8e-17	63.1
TkA01G066780	`PF30572`	DUF8639	166	175	7.9	7.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card