TkA01G023310 | RubberDandelionOmics

Gene overview

TkA01G023310

Reference: TK1151 Chr: Chr01 Coordinates: 5982719-5986260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1320 bp · TkA01G023310|TK1151|cDNA

CTGACATCATTTAAGCAGAGGCAGATGGACAACACAGAAAAAGCTACTGGTGTTTTGGGCCAAGAAATCACATGCTCAGCTGCCGTGTGTTGGGGTCCTGGGCAGCCTTTCTCCATACAACAAATTCGTGTCCAACCACCTCAAAAACTGGAAGTACGAATTAGAATCTTGTACACTTCAGTTTGTCATACTGATCTTAGTGCGTGGCAGGGAGAGAATGAATCGCAACGCATGTACCCTCGGATTTTTGGACATGAAGC...

CDS

Download CDS FASTA

1164 bp · TkA01G023310|TK1151|CDS

ATGGACAACACAGAAAAAGCTACTGGTGTTTTGGGCCAAGAAATCACATGCTCAGCTGCCGTGTGTTGGGGTCCTGGGCAGCCTTTCTCCATACAACAAATTCGTGTCCAACCACCTCAAAAACTGGAAGTACGAATTAGAATCTTGTACACTTCAGTTTGTCATACTGATCTTAGTGCGTGGCAGGGAGAGAATGAATCGCAACGCATGTACCCTCGGATTTTTGGACATGAAGCCTCCGGGGTGGTTGAGTGTATAGG...

Protein

Download Protein FASTA

387 aa · TkA01G023310|TK1151|PROTEIN

MDNTEKATGVLGQEITCSAAVCWGPGQPFSIQQIRVQPPQKLEVRIRILYTSVCHTDLSAWQGENESQRMYPRIFGHEASGVVECIGEGVEDMKEGDHVLTIFNGECRECAYCKSESTNLCEKFRVDPLRNTMRNDGKTRFLTQEGKPIYHFLNTSTFSEYTVIDSACVVKIDPKAPLDKMTLLSCCVSTGYGAVTNDANIHQGSTVAVFGLGAVGLAVIQGAKTRGASRIIGVDINVDKDIKGKTMGMTDFINPRDLKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G023310`
TK1151 ID	TkA01G023310
OH-1004 ID	LXL04_026242
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.400
Protein coverage (%)	TK1151 99.483 / OH-1004 97.710 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G023310

Location Chr01:5982719-5986260 (+)

Description Similar to At1g32780: Alcohol dehydrogenase-like 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32780`	Alcohol dehydrogenase-like 3.	No verified direct reference in this release
`At1g64710`	Alcohol dehydrogenase-like 4.	No verified direct reference in this release
`At4g22110`	Alcohol dehydrogenase-like 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026242 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046294 formaldehyde catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004022 alcohol dehydrogenase (NAD+) activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0051903 S-(hydroxymethyl)glutathione dehydrogenase [NAD(P)+] activity Molecular Function

KEGG gene cross-reference

ath:AT1G32780

ath:AT1G64710

sot:102577519

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · TkA01G023310 · TK1151

Nucleus0.181

Rank 2 · TkA01G023310 · TK1151

Mitochondrion0.120

Rank 3 · TkA01G023310 · TK1151

Peroxisome0.107

Rank 4 · TkA01G023310 · TK1151

Cell membrane0.101

Rank 5 · TkA01G023310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240ADH_N43-173 aa

PF028262-Hacid_dh_C202-246 aa

PF16912Glu_dehyd_C203-373 aa

PF00107ADH_zinc_N214-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G023310	`PF08240`	ADH_N	43	173	1.7e-21	77.1
TkA01G023310	`PF02826`	2-Hacid_dh_C	202	246	0.034	14.2
TkA01G023310	`PF16912`	Glu_dehyd_C	203	373	0.048	13.8
TkA01G023310	`PF00107`	ADH_zinc_N	214	333	2.5e-19	70.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A1L4Y2`	Arabidopsis thaliana	sp\|A1L4Y2\|ADHL3_ARATH Alcohol dehydrogenase-like 3	65.600%	Swiss-Prot	High
`Q8VZ49`	Arabidopsis thaliana	sp\|Q8VZ49\|ADHL4_ARATH Alcohol dehydrogenase-like 4	62.900%	Swiss-Prot	High
`Q0V7W6`	Arabidopsis thaliana	sp\|Q0V7W6\|ADHL5_ARATH Alcohol dehydrogenase-like 5	43.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card