Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2169 bp · TkA01G000340|TK1151|cDNA
TTTAAATATGACACGTAAAAGAGACATGATTTTTGTTTTCCACCGGGAAAGAGGAACAGACATCACATAAATCATCGTCCCCAAATCTCTCTCTGCCTCTCCTCCATTATCACCTAACCCTAGCAATGGGACAACAAGACTCAGGATCGTGTCTCACCGAAGAAGACGATGCCATATTCAGCGATTCCCTTGAAGAATTCCCCGTAACAGAGGCTTCCAACTCTATCGAGTTTGAATACTCACTTCCCCAATCCACCACT...
1680 bp · TkA01G000340|TK1151|CDS
ATGGGACAACAAGACTCAGGATCGTGTCTCACCGAAGAAGACGATGCCATATTCAGCGATTCCCTTGAAGAATTCCCCGTAACAGAGGCTTCCAACTCTATCGAGTTTGAATACTCACTTCCCCAATCCACCACTTCATCAGTTTCTGAGATCGCTGAAAACTACCGGGTATCAATTTCAAACCTATCAAAGCACACGCCGGAGTCGCAATCATTCCCTTCCTACACTGGTGTCCGACGTCGCCGACATATTCCCCGACA...
Protein
Download Protein FASTA559 aa · TkA01G000340|TK1151|PROTEIN
MGQQDSGSCLTEEDDAIFSDSLEEFPVTEASNSIEFEYSLPQSTTSSVSEIAENYRVSISNLSKHTPESQSFPSYTGVRRRRHIPRQNCKELPLSPFKNIPDGFVDFDVHESTISPGKNHKLFWKLKDADKLNGKLNRTKVRVRSDSVEKEFADKRSANCSDSSVITTDENVRDGSVIVDSPNSDSNFLFTLAGLTLRAIAFQITLLVGFVTFPIWLLHSSYLFLIDPFTIIRTAKRYLIRTISSLLKFCFGNVKRIFFQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G000340 |
|---|---|
| TK1151 ID | TkA01G000340 |
| OH-1004 ID | LXL04_036623 |
| Relationship / confidence | Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 92.129 / OH-1004 97.538Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G000340 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:81790-84409 (+) | |||||||||
| Description | Similar to SEI2: Seipin-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006629 lipid metabolic process Biological Process GO:0009846 pollen germination Biological Process GO:0010162 seed dormancy process Biological Process GO:0010344 seed oilbody biogenesis Biological Process GO:0016042 lipid catabolic process Biological Process GO:0019915 lipid storage Biological Process GO:0034389 lipid droplet organization Biological Process GO:0043086 negative regulation of catalytic activity Biological Process GO:0048316 seed development Biological Process GO:0048515 spermatid differentiation Biological Process GO:0050995 negative regulation of lipid catabolic process Biological Process GO:0061725 cytosolic lipolysis Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G29760 ath:AT2G34380 ath:AT5G16460 bta:513558 rno:361722 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF06775Seipin291-524 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G000340 | PF06775 | Seipin | 291 | 524 | 5e-47 | 161.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.