LXL04_039750 | RubberDandelionOmics

Gene overview

LXL04_039750

Reference: OH-1004 Chr: JAJTUU010000035.1 Coordinates: 96065-96936 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

632 bp · LXL04_039750|LXL04_039750|OH1004|cDNA

AGATTTTCGCAGATTACGCCGAAGAGCCAGCTACAAATGTCAAATTTCCGACATTGTTGAGTCTCCCTGGTTGCTCGAGCTCGCTTTCTTTGATTGGCACAGGATTTCGAGAAAAGGTTTTTGCCATAATCGGAGTTAAGGTGTACGCAGCAGGGCTATACATAAACCCTAAAATCATCGAGAAATTACCCGCCTGGAAAGGACGAACACCGGCTCAGATCCAAGACGATTCTTCTTTATTTGATCTAATCTACAACGCT...

CDS

Download CDS FASTA

579 bp · LXL04_039750|LXL04_039750|OH1004|CDS

TTGTTGAGTCTCCCTGGTTGCTCGAGCTCGCTTTCTTTGATTGGCACAGGATTTCGAGAAAAGGTTTTTGCCATAATCGGAGTTAAGGTGTACGCAGCAGGGCTATACATAAACCCTAAAATCATCGAGAAATTACCCGCCTGGAAAGGACGAACACCGGCTCAGATCCAAGACGATTCTTCTTTATTTGATCTAATCTACAACGCTCCATTAGAGAAATCGTTACAGATCGTGTTAGTCAGAGACGTCGACGGAAAAAC...

Protein

Download Protein FASTA

192 aa · LXL04_039750|LXL04_039750|OH1004|PROTEIN

MLSLPGCSSSLSLIGTGFREKVFAIIGVKVYAAGLYINPKIIEKLPAWKGRTPAQIQDDSSLFDLIYNAPLEKSLQIVLVRDVDGKTFWDALNDAISPRIKSPTAVDETALSDFRGIFQNRPLKKGTFIFLTWLDSSKILIHLSNDGIPSTSEATIEAENVTRSLFDVFFGRDSVSPSLKASISNGLASSLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039750`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039750

Location JAJTUU010000035.1:96065-96936 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53520`	Fatty-acid-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039750 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005504 fatty acid binding Molecular Function

GO:0016872 intramolecular lyase activity Molecular Function

GO:0045430 chalcone isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G53520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.291

Rank 1 · LXL04_039750 · OH-1004

Mitochondrion0.259

Rank 2 · LXL04_039750 · OH-1004

Plastid0.252

Rank 3 · LXL04_039750 · OH-1004

Cytoplasm0.245

Rank 4 · LXL04_039750 · OH-1004

Nucleus0.080

Rank 5 · LXL04_039750 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02431.21Chalcone5-187 aa

PF16035.11Chalcone_211-183 aa

PF16036.11Chalcone_365-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039750	`PF02431.21`	Chalcone	5	187	6.7e-20	72.1
LXL04_039750	`PF16035.11`	Chalcone_2	11	183	1.1e-13	52.2
LXL04_039750	`PF16036.11`	Chalcone_3	65	182	2.1e-12	48.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8L2`	Arabidopsis thaliana	Fatty-acid-binding protein 3, chloroplastic	65.789%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card