LXL04_038302 | RubberDandelionOmics

Gene overview

LXL04_038302

Reference: OH-1004 Chr: Chr09 Coordinates: 36810268-36811187 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · LXL04_038302|LXL04_038302|OH1004|cDNA

ATGTTCTTCAGCTTCACACCTTTTAAAGGCATGAAATCAAAAATCGTTCCTTACTACATGAACGGAAATCCATCCAGTCTCTTCTGCATCTTGCCAAGAGACGATTCTTCCCGCTTTTTCCCTCCGGGCACCGCCCCTGTTTACCTTAACGTCTACGACATCTCCACCATCAACAGTTGCATATCATGGACAGGCATCGGCGCCTTTCACACAGGTTTAGAAGGTAACCAAACCTCCATTTTCTTCAATCATTTCCCTCC...

CDS

Download CDS FASTA

843 bp · LXL04_038302|LXL04_038302|OH1004|CDS

ATGTTCTTCAGCTTCACACCTTTTAAAGGCATGAAATCAAAAATCGTTCCTTACTACATGAACGGAAATCCATCCAGTCTCTTCTGCATCTTGCCAAGAGACGATTCTTCCCGCTTTTTCCCTCCGGGCACCGCCCCTGTTTACCTTAACGTCTACGACATCTCCACCATCAACAGTTGCATATCATGGACAGGCATCGGCGCCTTTCACACAGGTTTAGAAGGTAACCAAACCTCCATTTTCTTCAATCATTTCCCTCC...

Protein

Download Protein FASTA

280 aa · LXL04_038302|LXL04_038302|OH1004|PROTEIN

MFFSFTPFKGMKSKIVPYYMNGNPSSLFCILPRDDSSRFFPPGTAPVYLNVYDISTINSCISWTGIGAFHTGLEGNQTSIFFNHFPPISNSNRSFRLITVHGVEYGFGCHQESESGVFEIEPRKCPGFKFRESILMGTTKLSPSQVQRFIELQSNNYYGDTYHLFGKNCNHFCDDMCHKLTGNKIPRWVNRLARIGSCCRCILPKSIKGSAVKNKSNSDEDEHKSLRGSFSCFSSFSTHNKLRKVSISSLYKHSLYKGCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038302`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038302

Location Chr09:36810268-36811187 (+)

Description Similar to At4g17486: DeSI-like protein At4g17486

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17486`	DeSI-like protein At4g17486.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038302 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

GO:0008474 palmitoyl-(protein) hydrolase activity Molecular Function

GO:0052816 long-chain fatty acyl-CoA hydrolase activity Molecular Function

GO:0061578 K63-linked deubiquitinase activity Molecular Function

GO:0101005 deubiquitinase activity Molecular Function

GO:1990380 K48-linked deubiquitinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G17486

dre:445138

pon:100174052

ssc:100037270

xla:496020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.312

Rank 1 · LXL04_038302 · OH-1004

Nucleus0.234

Rank 2 · LXL04_038302 · OH-1004

Endoplasmic reticulum0.197

Rank 3 · LXL04_038302 · OH-1004

Cell membrane0.163

Rank 4 · LXL04_038302 · OH-1004

Golgi apparatus0.159

Rank 5 · LXL04_038302 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05903.21Peptidase_C9746-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038302	`PF05903.21`	Peptidase_C97	46	205	5.9e-44	150.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VG8`	Arabidopsis thaliana	DeSI-like protein At4g17486	44.828%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card