LXL04_037059 | RubberDandelionOmics

Gene overview

LXL04_037059

Reference: OH-1004 Chr: Chr08 Coordinates: 52473470-52477826 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4089 bp · LXL04_037059|LXL04_037059|OH1004|cDNA

ATGGACTCGAAGGAAGATACGTCTCTCTCAGGtttttcttctgtttcttcCGATAACATCGAAACTGTTAACGAAACGAATGGTTTGAAATCAGTTGACAAAGTTGATAATAATAAAGCTAGTAGTCTGAACGTTACTTCCGATGACGAGGGTTTTGCTAGTGGTCAGGAGGAGGCTTTTGAGACAATTTTAGAGGAGAATTCAGAAGCCGTAGTGAATGTAGACGAAGCTGTGGATGACGGTGAGAAGTTTTCAGAGGC...

CDS

Download CDS FASTA

4089 bp · LXL04_037059|LXL04_037059|OH1004|CDS

ATGGACTCGAAGGAAGATACGTCTCTCTCAGGTTTTTCTTCTGTTTCTTCCGATAACATCGAAACTGTTAACGAAACGAATGGTTTGAAATCAGTTGACAAAGTTGATAATAATAAAGCTAGTAGTCTGAACGTTACTTCCGATGACGAGGGTTTTGCTAGTGGTCAGGAGGAGGCTTTTGAGACAATTTTAGAGGAGAATTCAGAAGCCGTAGTGAATGTAGACGAAGCTGTGGATGACGGTGAGAAGTTTTCAGAGGC...

Protein

Download Protein FASTA

1362 aa · LXL04_037059|LXL04_037059|OH1004|PROTEIN

MDSKEDTSLSGFSSVSSDNIETVNETNGLKSVDKVDNNKASSLNVTSDDEGFASGQEEAFETILEENSEAVVNVDEAVDDGEKFSEASETPLPKVESLPMIDEVVKGNLGLVEEVADENRESDEKLNSNAVVKEEVVEGIEGDKVTESKRDVVDESVSKAVNSDEVKSGTPEEGEKEVVVANGVKLTPEGDAVVEEIKVDTPVPGVAVVSNIEDVEEDDEDEEVLLVGGPDDTNSVVEEPELESFGADDVKITSDLESVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037059`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037059

Location Chr08:52473470-52477826 (+)

Description Similar to TOC159: Translocase of chloroplast 159, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02510`	GTPase involved in protein precursor import into chloroplasts.	The major protein import receptor of plastids is essential for chloroplast biogenesis.2000 · DOI: 10.1038/35003214 Dimerization of Toc-GTPases at the chloroplast protein import machinery.2003 · DOI: 10.1074/jbc.m305946200 The roles of toc34 and toc75 in targeting the toc159 preprotein receptor to chloroplasts.2003 · DOI: 10.1074/jbc.m307873200 Functional specialization amongst the Arabidopsis Toc159 family of chloroplast protein import receptors.2004 · DOI: 10.1105/tpc.104.023309 AtToc90, a new GTP-binding component of the Arabidopsis chloroplast protein import machinery.2004 · DOI: 10.1023/b:plan.0000036374.92546.51 Deletion of core components of the plastid protein import machinery causes differential arrest of embryo development in Arabidopsis thaliana.2006 · DOI: 10.1055/s-2005-873044
`At2g16640`	GTPase involved in protein precursor import into chloroplasts.	Functional specialization amongst the Arabidopsis Toc159 family of chloroplast protein import receptors.2004 · DOI: 10.1105/tpc.104.023309 Deletion of core components of the plastid protein import machinery causes differential arrest of embryo development in Arabidopsis thaliana.2006 · DOI: 10.1055/s-2005-873044
`At3g16620`	GTPase involved in protein precursor import into chloroplasts.	Functional specialization amongst the Arabidopsis Toc159 family of chloroplast protein import receptors.2004 · DOI: 10.1105/tpc.104.023309

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037059 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045036 protein targeting to chloroplast Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0061927 TOC-TIC supercomplex I Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0004888 transmembrane signaling receptor activity Molecular Function

GO:0004930 G protein-coupled receptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G16640

ath:AT3G16620

ath:AT4G02510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.233

Rank 1 · LXL04_037059 · OH-1004

Endoplasmic reticulum0.199

Rank 2 · LXL04_037059 · OH-1004

Cytoplasm0.195

Rank 3 · LXL04_037059 · OH-1004

Nucleus0.161

Rank 4 · LXL04_037059 · OH-1004

Cell membrane0.151

Rank 5 · LXL04_037059 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04548.23AIG1716-849 aa

PF01926.30MMR_HSR1717-809 aa

PF11886.14TOC159_MAD1079-1341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037059	`PF04548.23`	AIG1	716	849	1.5e-18	67.7
LXL04_037059	`PF01926.30`	MMR_HSR1	717	809	1.4e-09	38.8
LXL04_037059	`PF11886.14`	TOC159_MAD	1079	1341	1.1e-119	399.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81283`	Arabidopsis thaliana	Translocase of chloroplast 159, chloroplastic	65.665%	Swiss-Prot	moderate database homology
`Q9SLF3`	Arabidopsis thaliana	Translocase of chloroplast 132, chloroplastic	51.511%	Swiss-Prot	moderate database homology
`Q9LUS2`	Arabidopsis thaliana	Translocase of chloroplast 120, chloroplastic	51.047%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card