RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_036098
Reference: OH-1004 Chr: Chr08 Coordinates: 35638900-35642228 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2229 bp · LXL04_036098|LXL04_036098|OH1004|cDNA

atgcttcttcttcttttcacccTCGTTCTATTTACTTCAAGTTTCACCCCAACAGCCATGGGGAAGATAGGAAAGCCAGGATGCCGAACCCAATGCGGGAACTTGACGATCCAATACCCTTTTGGCATAGACAAAGGCTGTTCCATGGACGAATCATTTGATCTAACCTGCAACTTAACTACTACCCCCCCAAAGCTTTTCATCGGATCAGGGAACATCGAAATCTACAATATTTCAGGACCCGAGATGAAAATCTCCAA...

CDS

Download CDS FASTA

2229 bp · LXL04_036098|LXL04_036098|OH1004|CDS

ATGCTTCTTCTTCTTTTCACCCTCGTTCTATTTACTTCAAGTTTCACCCCAACAGCCATGGGGAAGATAGGAAAGCCAGGATGCCGAACCCAATGCGGGAACTTGACGATCCAATACCCTTTTGGCATAGACAAAGGCTGTTCCATGGACGAATCATTTGATCTAACCTGCAACTTAACTACTACCCCCCCAAAGCTTTTCATCGGATCAGGGAACATCGAAATCTACAATATTTCAGGACCCGAGATGAAAATCTCCAA...

Protein

Download Protein FASTA

742 aa · LXL04_036098|LXL04_036098|OH1004|PROTEIN

MLLLLFTLVLFTSSFTPTAMGKIGKPGCRTQCGNLTIQYPFGIDKGCSMDESFDLTCNLTTTPPKLFIGSGNIEIYNISGPEMKISNSIGFRCYNESGYATYELIAWTNLETTPFSFSQKNKFTVIGCDDSALITGRNGIDFTSGCLGLCSKASDVPIGYCSGNGCCQTSIPKGLKFYNVSLGSFNNHEKVHSFNPCGFAFLGEEESFTFGGVPDLSDMDLDVKIDNSLRIVVDWVIGGKRNCTQAMECKGNSFCEDEET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_036098
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_036098
LocationChr08:35638900-35642228 (-)
DescriptionSimilar to WAK2: Wall-associated receptor kinase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g21270 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21230 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21250 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Oxygen-evolving enhancer protein 2 is phosphorylated by glycine-rich protein 3/wall-associated kinase 1 in Arabidopsis.2003 · DOI: 10.1016/s0006-291x(03)00851-9
Aluminum-induced gene expression and protein localization of a cell wall-associated receptor kinase in Arabidopsis.2003 · DOI: 10.1104/pp.103.022129
At1g21240 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21210 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Antisense expression of a cell wall-associated protein kinase, WAK4, inhibits cell elongation and alters morphology.2001 · DOI: 10.1105/tpc.13.6.1317

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036098 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0007166 cell surface receptor signaling pathway Biological Process
GO:0009311 oligosaccharide metabolic process Biological Process
GO:0009615 response to virus Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009992 intracellular water homeostasis Biological Process
GO:0048527 lateral root development Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G21210
ath:AT1G21230
ath:AT1G21240
ath:AT1G21250
ath:AT1G21270
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.875
Rank 1 · LXL04_036098 · OH-1004
Cytoplasm0.076
Rank 2 · LXL04_036098 · OH-1004
Endoplasmic reticulum0.070
Rank 3 · LXL04_036098 · OH-1004
Nucleus0.044
Rank 4 · LXL04_036098 · OH-1004
Lysosome / Vacuole0.026
Rank 5 · LXL04_036098 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947.12GUB_WAK_bind28-80 aa
PF07645.22EGF_CA283-324 aa
PF12947.14EGF_3298-319 aa
PF00069.32Pkinase409-676 aa
PF07714.24PK_Tyr_Ser-Thr412-680 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_036098PF13947.12GUB_WAK_bind28802.1e-0938.3
LXL04_036098PF07645.22EGF_CA2833241.2e-0629.3
LXL04_036098PF12947.14EGF_32983192.9e-0731.3
LXL04_036098PF00069.32Pkinase4096762.8e-46158.8
LXL04_036098PF07714.24PK_Tyr_Ser-Thr4126805.1e-44151.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LMP1Arabidopsis thalianaWall-associated receptor kinase 245.869%Swiss-Protmoderate database homology
Q9LMN7Arabidopsis thalianaWall-associated receptor kinase 544.521%Swiss-Protmoderate database homology
Q39191Arabidopsis thalianaWall-associated receptor kinase 143.454%Swiss-Protmoderate database homology
Q9LMN8Arabidopsis thalianaWall-associated receptor kinase 343.113%Swiss-Protmoderate database homology
Q9LMN6Arabidopsis thalianaWall-associated receptor kinase 442.244%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser