LXL04_035645 | RubberDandelionOmics

Gene overview

LXL04_035645

Reference: OH-1004 Chr: Chr08 Coordinates: 26244991-26250174 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1947 bp · LXL04_035645|LXL04_035645|OH1004|cDNA

ATGACAGAATCCGGAGGGGAGAAAAAGAAGAGAGTGGTGGTTATTGGCGGCGGCGTAGCAGGTTCTCTTCTTTGCAAAACCCTTCAAAAACATCGACATTTTGATTTCACCCTCATTGATTCGAAAGAGTATTTTGAGGTCACATGGGCAAGATTAAGGTCAATGGTGGAACCATCATTTGCAAAAAGATCTATAATCAATCACCACGAATATCTTCAAGGAGCAAGCATTATCACATCTGATGCAAACGGGATTGAAGA...

CDS

Download CDS FASTA

1947 bp · LXL04_035645|LXL04_035645|OH1004|CDS

ATGACAGAATCCGGAGGGGAGAAAAAGAAGAGAGTGGTGGTTATTGGCGGCGGCGTAGCAGGTTCTCTTCTTTGCAAAACCCTTCAAAAACATCGACATTTTGATTTCACCCTCATTGATTCGAAAGAGTATTTTGAGGTCACATGGGCAAGATTAAGGTCAATGGTGGAACCATCATTTGCAAAAAGATCTATAATCAATCACCACGAATATCTTCAAGGAGCAAGCATTATCACATCTGATGCAAACGGGATTGAAGA...

Protein

Download Protein FASTA

648 aa · LXL04_035645|LXL04_035645|OH1004|PROTEIN

MTESGGEKKKRVVVIGGGVAGSLLCKTLQKHRHFDFTLIDSKEYFEVTWARLRSMVEPSFAKRSIINHHEYLQGASIITSDANGIEDEEVSTTEGRLISYDYLVIATGHIGSKCVTKSEKLREYEADNEKIKSAESILIIGGGPTGVELAGEIAVDFPTKKVKLVHRGSRLLEFIDEKASKKVLDWLTIKKVEVILGQSVDLASRSEDGTYQTSEGETIMADCHFQCTSDPIGSSWLKNTILKDSLTDSGRLMVDPNMRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035645`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035645

Location Chr08:26244991-26250174 (+)

Description Similar to VPS60-2: Vacuolar protein sorting-associated protein 60.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04850`	Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release
`At3g10640`	Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035645 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001919 regulation of receptor recycling Biological Process

GO:0006900 vesicle budding from membrane Biological Process

GO:0006914 autophagy Biological Process

GO:0006997 nucleus organization Biological Process

GO:0007040 lysosome organization Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0008333 endosome to lysosome transport Biological Process

GO:0010824 regulation of centrosome duplication Biological Process

GO:0015031 protein transport Biological Process

GO:0031468 nuclear membrane reassembly Biological Process

GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway Biological Process

GO:0036258 multivesicular body assembly Biological Process

KEGG gene cross-reference

ath:AT3G10640

ath:AT5G04850

mmu:76959

pon:100172361

rno:297995

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.405

Rank 1 · LXL04_035645 · OH-1004

Mitochondrion0.272

Rank 2 · LXL04_035645 · OH-1004

Peroxisome0.184

Rank 3 · LXL04_035645 · OH-1004

Nucleus0.179

Rank 4 · LXL04_035645 · OH-1004

Cell membrane0.102

Rank 5 · LXL04_035645 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07992.21Pyr_redox_211-288 aa

PF00070.34Pyr_redox137-209 aa

PF03357.27Snf7429-623 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035645	`PF07992.21`	Pyr_redox_2	11	288	1.2e-31	111.0
LXL04_035645	`PF00070.34`	Pyr_redox	137	209	7.3e-13	49.6
LXL04_035645	`PF03357.27`	Snf7	429	623	9.3e-49	166.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMC5`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 60.2	78.903%	Swiss-Prot	weak database homology
`Q9LPN5`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 60.1	76.695%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card