LXL04_035460 | RubberDandelionOmics

Gene overview

LXL04_035460

Reference: OH-1004 Chr: Chr08 Coordinates: 22980196-22984091 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3138 bp · LXL04_035460|LXL04_035460|OH1004|cDNA

ATGGAAGAGGTTGGTACTCAGCTAGCTCCTCCGTTATATATGTACAACTCAATCGGTGCCGGAAGATTCCCCGATACCCATCCGATGGCCAAGAAACGAAGCCTGCCGTATCAAAACTCAAACTTTATTCAACATCAGCAACAGCAACAGTATCTACAAAGGTTAATCCCAAGTTTAAACGAGCCTAGGAACAGTTGGAACCCTAAAAATTGGGAATGGGACAGTTCACGACTCGTGGCTAAACCCTTGGATATGATGGA...

CDS

Download CDS FASTA

3138 bp · LXL04_035460|LXL04_035460|OH1004|CDS

ATGGAAGAGGTTGGTACTCAGCTAGCTCCTCCGTTATATATGTACAACTCAATCGGTGCCGGAAGATTCCCCGATACCCATCCGATGGCCAAGAAACGAAGCCTGCCGTATCAAAACTCAAACTTTATTCAACATCAGCAACAGCAACAGTATCTACAAAGGTTAATCCCAAGTTTAAACGAGCCTAGGAACAGTTGGAACCCTAAAAATTGGGAATGGGACAGTTCACGACTCGTGGCTAAACCCTTGGATATGATGGA...

Protein

Download Protein FASTA

1045 aa · LXL04_035460|LXL04_035460|OH1004|PROTEIN

MEEVGTQLAPPLYMYNSIGAGRFPDTHPMAKKRSLPYQNSNFIQHQQQQQYLQRLIPSLNEPRNSWNPKNWEWDSSRLVAKPLDMMEISQEQEQQHQQQQHHQTAINPPNPDVSKKSSGGQREEDERLLLKLGGGEEPATRPSKRVRSGSPGTGCAGNYPMCQVDNCKEDLSTAKDYHRRHKVCEVHSKAGKALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQPEDVASQLLLPGNNDKNGAKEMN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035460`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035460

Location Chr08:22980196-22984091 (-)

Description Similar to SPL14: Squamosa promoter-binding-like protein 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20980`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity).	Arabidopsis AtSPL14, a plant-specific SBP-domain transcription factor, participates in plant development and sensitivity to fumonisin B1.2005 · DOI: 10.1111/j.1365-313x.2005.02334.x
`At1g76580`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release
`At3g60030`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	An Arabidopsis SBP-domain fragment with a disrupted C-terminal zinc-binding site retains its tertiary structure.2006 · DOI: 10.1016/j.febslet.2006.03.014

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0513700`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release
`UniProt: A2YX04`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035460 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G20980

ath:AT3G60030

dosa:Os08g0513700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.622

Rank 1 · LXL04_035460 · OH-1004

Cytoplasm0.310

Rank 2 · LXL04_035460 · OH-1004

Cell membrane0.097

Rank 3 · LXL04_035460 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_035460 · OH-1004

Mitochondrion0.051

Rank 5 · LXL04_035460 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03110.20SBP162-235 aa

PF26102.1Ig_SPL7645-752 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035460	`PF03110.20`	SBP	162	235	6.3e-31	107.2
LXL04_035460	`PF26102.1`	Ig_SPL7	645	752	3.4e-31	108.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY95`	Arabidopsis thaliana	Squamosa promoter-binding-like protein 14	48.869%	Swiss-Prot	moderate database homology
`Q700C2`	Arabidopsis thaliana	Squamosa promoter-binding-like protein 16	47.053%	Swiss-Prot	moderate database homology
`Q9S7P5`	Arabidopsis thaliana	Squamosa promoter-binding-like protein 12	36.431%	Swiss-Prot	weak database homology
`Q6Z8M8`	Oryza sativa subsp. japonica	Squamosa promoter-binding-like protein 15	45.554%	Swiss-Prot	moderate database homology
`A2YX04`	Oryza sativa subsp. indica	Squamosa promoter-binding-like protein 15	45.554%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card