LXL04_035419 | RubberDandelionOmics

Gene overview

LXL04_035419

Reference: OH-1004 Chr: Chr08 Coordinates: 22201961-22206410 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2073 bp · LXL04_035419|LXL04_035419|OH1004|cDNA

ATGGCGGGAGGAAAGCAAGGCGAGTTAGTGGTTCAAACGCCAAACGATTTGGCCCACAATCCAATCACACAATTGCAAACCAAGTACAAAGAATTAGAGAACGGCTTCAAGGCATGGCTTGCGAAACAGTCTTTACCGGTTGAGGCCGCCGTCGTTACCCTCACAAGCGCAACCCAGGGCGCAGCCATGGGTGGTTTCATGGGCACACTCACCAACGATGTCTCCTCCGCTTTCCCCGCCGCACCACCTCCCGGCTCCTC...

CDS

Download CDS FASTA

2073 bp · LXL04_035419|LXL04_035419|OH1004|CDS

ATGGCGGGAGGAAAGCAAGGCGAGTTAGTGGTTCAAACGCCAAACGATTTGGCCCACAATCCAATCACACAATTGCAAACCAAGTACAAAGAATTAGAGAACGGCTTCAAGGCATGGCTTGCGAAACAGTCTTTACCGGTTGAGGCCGCCGTCGTTACCCTCACAAGCGCAACCCAGGGCGCAGCCATGGGTGGTTTCATGGGCACACTCACCAACGATGTCTCCTCCGCTTTCCCCGCCGCACCACCTCCCGGCTCCTC...

Protein

Download Protein FASTA

690 aa · LXL04_035419|LXL04_035419|OH1004|PROTEIN

MAGGKQGELVVQTPNDLAHNPITQLQTKYKELENGFKAWLAKQSLPVEAAVVTLTSATQGAAMGGFMGTLTNDVSSAFPAAPPPGSSVNPQAMASFQQAQALAGGPLIQARNFAVMTGVNAGISCVLRRLRGKEDVQSSMAAAFGSGVMFTLVSGMGGPNQATNVITSGLFFALVQGGLFKVGEKFSKPSVEDVMYSETRAMLSNLGLGNYEKNFKKGFALKDVSIPPGPRLVILDHVQSNLMAPYMVRTYTTPPFLNPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035419`
TK1151 ID	TkA04G132260
OH-1004 ID	LXL04_035419
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 37.246 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035419

Location Chr08:22201961-22206410 (+)

Description Similar to HP30-2: Chloroplastic import inner membrane translocase subunit HP30-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24650`	Together with HP30-1 and HP20, triggers the import and insertion of transit sequence-less multi-pass transmembrane proteins (e.g. CEQORH) into the chloroplastic inner membrane.	Three proteins mediate import of transit sequence-less precursors into the inner envelope of chloroplasts in Arabidopsis thaliana.2013 · DOI: 10.1073/pnas.1319648110
`At3g49560`	Together with HP30-2 and HP20, triggers the import and insertion of transit sequence-less multi-pass transmembrane proteins (e.g. CEQORH) into the chloroplastic inner membrane.	No verified direct reference in this release
`At4g24180`	Involved in local responses of roots to colonization by non-pathogenic plant growth-promoting rhizobacteria (PGPR) fluorescent Pseudomonas spp., but does not seem to be required for the establishment of subsequent induced systemic resistance (ISR).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035419 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0016031 tRNA import into mitochondrion Biological Process

GO:0031640 killing of cells of another organism Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

KEGG gene cross-reference

ath:AT3G49560

ath:AT4G24180

ath:AT5G24650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.235

Rank 1 · LXL04_035419 · OH-1004

Endoplasmic reticulum0.189

Rank 2 · LXL04_035419 · OH-1004

Cell membrane0.148

Rank 3 · LXL04_035419 · OH-1004

Lysosome / Vacuole0.137

Rank 4 · LXL04_035419 · OH-1004

Cytoplasm0.116

Rank 5 · LXL04_035419 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02466.25Tim1749-175 aa

PF00314.23Thaumatin300-517 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035419	`PF02466.25`	Tim17	49	175	3.5e-12	47.3
LXL04_035419	`PF00314.23`	Thaumatin	300	517	1e-78	264.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLT9`	Arabidopsis thaliana	Chloroplastic import inner membrane translocase subunit HP30-2	57.021%	Swiss-Prot	weak database homology
`Q9SCK3`	Arabidopsis thaliana	Chloroplastic import inner membrane translocase subunit HP30-1	53.975%	Swiss-Prot	weak database homology
`A0A1P8B554`	Arabidopsis thaliana	Thaumatin-like protein 1	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card