Gene Card
Gene overview
cDNA / CDS / Protein Sequences
363 bp · LXL04_033841|LXL04_033841|OH1004|cDNA
ATGTTTCTGTTTGATTGGTTCTATGGCATCCTGGCCTCCCTCGGTTTATGGCAGAAAGAAGCCAAGATCTTGTTCCTTGGCCTCGATAATGCTGGTAAAACTACCTTGCTTCACATGCTTAAAGACGAGAGATTAGTTCAACATCAACCGACGCAACATCCGACCTCCGAAGAATTGAGTATTGGGAAAATCAAGTTCAAAGCCTTCGATTTGGGAGGTCATCAGATTGCTCGTAGAGTCTGGAAGGATTGTTACGCCAA...
363 bp · LXL04_033841|LXL04_033841|OH1004|CDS
ATGTTTCTGTTTGATTGGTTCTATGGCATCCTGGCCTCCCTCGGTTTATGGCAGAAAGAAGCCAAGATCTTGTTCCTTGGCCTCGATAATGCTGGTAAAACTACCTTGCTTCACATGCTTAAAGACGAGAGATTAGTTCAACATCAACCGACGCAACATCCGACCTCCGAAGAATTGAGTATTGGGAAAATCAAGTTCAAAGCCTTCGATTTGGGAGGTCATCAGATTGCTCGTAGAGTCTGGAAGGATTGTTACGCCAA...
Protein
Download Protein FASTA120 aa · LXL04_033841|LXL04_033841|OH1004|PROTEIN
MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDCYAKVCDFCIWFLSKYDIFKIIRFVFHCHLFPNLQHI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_033841 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_033841 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:60456232-60456715 (-) | |||||||||
| Description | Similar to SAR1B: GTP-binding protein SAR1B | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0003400 regulation of COPII vesicle coating Biological Process GO:0006886 intracellular protein transport Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0009555 pollen development Biological Process GO:0016050 vesicle organization Biological Process GO:0061024 membrane organization Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0030127 COPII vesicle coat Cellular Component GO:0032580 Golgi cisterna membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G56330 ath:AT4G02080 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00025.28Arf8-97 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_033841 | PF00025.28 | Arf | 8 | 97 | 7.8e-31 | 107.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.