LXL04_033279 | RubberDandelionOmics

Gene overview

LXL04_033279

Reference: OH-1004 Chr: Chr07 Coordinates: 40256344-40261952 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1710 bp · LXL04_033279|LXL04_033279|OH1004|cDNA

ATGCACTTGATCAAGGAGACAGCGAGTTTTGGAAAGAGGCCGGTAATGATGCTTTCAGAGTACAAGCATGAAAATATTATCTCCCTCCTTGGGTTCTGTGATGAGGAAGGCCGGAAGATACTTATATACAAATATGCTTCTAAGAAAAGTCTTGACGCACATCTCGATAACAAGGAGTTGGAGTGGGCTCAACGCCTTAAAATATGCATTGGTGCGGCTCAGGGACTAGCTTACATTCATGATCCTACAGGAAGCCAACA...

CDS

Download CDS FASTA

1710 bp · LXL04_033279|LXL04_033279|OH1004|CDS

ATGCACTTGATCAAGGAGACAGCGAGTTTTGGAAAGAGGCCGGTAATGATGCTTTCAGAGTACAAGCATGAAAATATTATCTCCCTCCTTGGGTTCTGTGATGAGGAAGGCCGGAAGATACTTATATACAAATATGCTTCTAAGAAAAGTCTTGACGCACATCTCGATAACAAGGAGTTGGAGTGGGCTCAACGCCTTAAAATATGCATTGGTGCGGCTCAGGGACTAGCTTACATTCATGATCCTACAGGAAGCCAACA...

Protein

Download Protein FASTA

569 aa · LXL04_033279|LXL04_033279|OH1004|PROTEIN

MHLIKETASFGKRPVMMLSEYKHENIISLLGFCDEEGRKILIYKYASKKSLDAHLDNKELEWAQRLKICIGAAQGLAYIHDPTGSQQRLLHRDIKSSKILLDENWNAIVSGFGLSRFGPANQKNTSIIIDNVVGTVGYVDPEYMESGILTKESDIYSFGVVLFEVLCGRLCIVSIQRPSLAMMIRRHIRRHKLENLEDIVWSNIKDDIHPESLKKFSAIAYKCLERDHEDRPELEEIIEVLKHCLKIQLTLNTNSSLVKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033279`
TK1151 ID	TkA08G244710
OH-1004 ID	LXL04_033279
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.100
Protein coverage (%)	TK1151 85.461 / OH-1004 34.271 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033279

Location Chr07:40256344-40261952 (-)

Description Similar to ANX2: Receptor-like protein kinase ANXUR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At5g24010`	Probable receptor-like protein kinase At5g24010.	No verified direct reference in this release
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033279 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G30570

ath:AT5G24010

ath:AT5G28680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.439

Rank 1 · LXL04_033279 · OH-1004

Cytoplasm0.411

Rank 2 · LXL04_033279 · OH-1004

Nucleus0.223

Rank 3 · LXL04_033279 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_033279 · OH-1004

Mitochondrion0.048

Rank 5 · LXL04_033279 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr15-241 aa

PF00069.32Pkinase16-239 aa

PF00069.32Pkinase352-480 aa

PF07714.24PK_Tyr_Ser-Thr354-479 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033279	`PF07714.24`	PK_Tyr_Ser-Thr	15	241	6.7e-54	183.6
LXL04_033279	`PF00069.32`	Pkinase	16	239	7.8e-48	163.9
LXL04_033279	`PF00069.32`	Pkinase	352	480	7.8e-48	163.9
LXL04_033279	`PF07714.24`	PK_Tyr_Ser-Thr	354	479	6.7e-54	183.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E8W4`	Arabidopsis thaliana	Receptor-like protein kinase ANXUR2	44.534%	Swiss-Prot	weak database homology
`Q9FLW0`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g24010	43.882%	Swiss-Prot	weak database homology
`Q9SA72`	Arabidopsis thaliana	Probable receptor-like protein kinase At1g30570	41.772%	Swiss-Prot	weak database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	41.176%	Swiss-Prot	weak database homology
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	40.909%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card