LXL04_029357 | RubberDandelionOmics

Gene overview

LXL04_029357

Reference: OH-1004 Chr: Chr06 Coordinates: 88309363-88309868 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · LXL04_029357|LXL04_029357|OH1004|cDNA

ATGCATTCAGTAAAAGAAAAGGTGAGCAATGCAGCAAGTGCTGCCAAGGCACATGTTGAATCCTACAAAGCCAATCTTGAAGAAAAGGCGGAGAAAGCAACTGCAAGAACGCCGGAAGAGAAAGAGATAGCACACCAGAGGAGGAAGGCAAAGGAAGCAGAAGCCAAGATGAATCTTCACGTTGAGAAAGCTGATCATGCAGCCGAGAAGTTGCATGGGAAACACCATGTTCTTGGCCATGACACGGCGGCCGGAGTTTA...

CDS

Download CDS FASTA

423 bp · LXL04_029357|LXL04_029357|OH1004|CDS

ATGCATTCAGTAAAAGAAAAGGTGAGCAATGCAGCAAGTGCTGCCAAGGCACATGTTGAATCCTACAAAGCCAATCTTGAAGAAAAGGCGGAGAAAGCAACTGCAAGAACGCCGGAAGAGAAAGAGATAGCACACCAGAGGAGGAAGGCAAAGGAAGCAGAAGCCAAGATGAATCTTCACGTTGAGAAAGCTGATCATGCAGCCGAGAAGTTGCATGGGAAACACCATGTTCTTGGCCATGACACGGCGGCCGGAGTTTA...

Protein

Download Protein FASTA

140 aa · LXL04_029357|LXL04_029357|OH1004|PROTEIN

MHSVKEKVSNAASAAKAHVESYKANLEEKAEKATARTPEEKEIAHQRRKAKEAEAKMNLHVEKADHAAEKLHGKHHVLGHDTAAGVYGGHHQTPVGTTGVVPGAVQHHHQHPLGAIDPVTGTTAPAYPLGGHLHGHNKHI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029357`
TK1151 ID	TkA07G306640
OH-1004 ID	LXL04_029357
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029357

Location Chr06:88309363-88309868 (+)

Description Similar to LEA6: Late embryogenesis abundant protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32560`	Involved dehydration tolerance.	No verified direct reference in this release
`At2g35300`	Involved dehydration tolerance.	The intrinsically disordered late embryogenesis abundant protein LEA18 from Arabidopsis thaliana modulates membrane stability through binding and folding.2011 · DOI: 10.1016/j.bbamem.2010.09.010
`At5g06760`	Involved dehydration tolerance.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029357 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0048316 seed development Biological Process

GO:0048868 pollen tube development Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004460 L-lactate dehydrogenase (cytochrome) activity Molecular Function

GO:0005034 osmosensor activity Molecular Function

GO:0005507 copper ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G32560

ath:AT2G35300

ath:AT5G06760

gmx:547828

sly:101253038

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.618

Rank 1 · LXL04_029357 · OH-1004

Nucleus0.311

Rank 2 · LXL04_029357 · OH-1004

Cell membrane0.162

Rank 3 · LXL04_029357 · OH-1004

Mitochondrion0.129

Rank 4 · LXL04_029357 · OH-1004

Endoplasmic reticulum0.034

Rank 5 · LXL04_029357 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03760.22LEA_11-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029357	`PF03760.22`	LEA_1	1	76	1.4e-28	99.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39138`	Arabidopsis thaliana	Late embryogenesis abundant protein 6	45.833%	Swiss-Prot	moderate database homology
`Q96273`	Arabidopsis thaliana	Late embryogenesis abundant protein 18	49.398%	Swiss-Prot	moderate database homology
`Q9FG31`	Arabidopsis thaliana	Late embryogenesis abundant protein 46	41.429%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card