Gene Card
Gene overview
cDNA / CDS / Protein Sequences
315 bp · LXL04_027542|LXL04_027542|OH1004|cDNA
ATGTGGAAATTGAAGATAGCAGAAGGGAGCGATCCCTACTTATTTAGCACCAACAACTTTGTTGGCCGTCAAACTTGGGAGTTCGATCCCAATGCGGGAACACCTGAAGATCGACAAGAAATTGAAAATGCTCGTCAATATTTTTTGAATCGAAAAAAGGAAGGTTTCCGATCATCCAGTGATTTGCTCATGCGGATACAGGTTGCTATGCAATCTCACACCTTACACCCCTTTGGACCGGACCTTCTTAAAAAGTATAT...
315 bp · LXL04_027542|LXL04_027542|OH1004|CDS
ATGTGGAAATTGAAGATAGCAGAAGGGAGCGATCCCTACTTATTTAGCACCAACAACTTTGTTGGCCGTCAAACTTGGGAGTTCGATCCCAATGCGGGAACACCTGAAGATCGACAAGAAATTGAAAATGCTCGTCAATATTTTTTGAATCGAAAAAAGGAAGGTTTCCGATCATCCAGTGATTTGCTCATGCGGATACAGGTTGCTATGCAATCTCACACCTTACACCCCTTTGGACCGGACCTTCTTAAAAAGTATAT...
Protein
Download Protein FASTA104 aa · LXL04_027542|LXL04_027542|OH1004|PROTEIN
MWKLKIAEGSDPYLFSTNNFVGRQTWEFDPNAGTPEDRQEIENARQYFLNRKKEGFRSSSDLLMRIQVAMQSHTLHPFGPDLLKKYIQLSADACKVNWFTKDYT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_027542 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_027542 |
|---|---|
| Location | Chr06:18507862-18509777 (-) |
| Description | Similar to DDS: Dammarenediol II synthase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002238 response to molecule of fungal origin Biological Process GO:0010038 response to metal ion Biological Process GO:0016104 triterpenoid biosynthetic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:1902438 response to vanadate(3-) Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005811 lipid droplet Cellular Component GO:0016829 lyase activity Molecular Function GO:0016866 intramolecular transferase activity Molecular Function GO:0031559 oxidosqualene cyclase activity Molecular Function GO:0042300 beta-amyrin synthase activity Molecular Function |
| KEGG gene cross-reference | ag:BAB68529 ag:BAF33291 ag:BAH23676 sly:100529102 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.