LXL04_026293 | RubberDandelionOmics

Gene overview

LXL04_026293

Reference: OH-1004 Chr: Chr05 Coordinates: 124502849-124505315 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · LXL04_026293|LXL04_026293|OH1004|cDNA

ATGGTTTCAGCCGATTTTGCTCGCAATCTTCTTGGTATCATAGGGAATGTCATTTCAATCATTTtgttcttatctacaatGCCAACGTTTTACAGGATATGGAAAAACAAGTCAGTCGAAAGATTTTCTCCAATCCCATATCTCGTCACCTTTGTGAATTGTGGGCTATGGATTTTCTACGGCTTGCCTTTGGTGCACCCTAATAGTTTACTAGTCACCACCACAAATGGTGCAGGAATAATCATCGAGTCTTTTTATTT...

CDS

Download CDS FASTA

1143 bp · LXL04_026293|LXL04_026293|OH1004|CDS

ATGGTTTCAGCCGATTTTGCTCGCAATCTTCTTGGTATCATAGGGAATGTCATTTCAATCATTTTGTTCTTATCTACAATGCCAACGTTTTACAGGATATGGAAAAACAAGTCAGTCGAAAGATTTTCTCCAATCCCATATCTCGTCACCTTTGTGAATTGTGGGCTATGGATTTTCTACGGCTTGCCTTTGGTGCACCCTAATAGTTTACTAGTCACCACCACAAATGGTGCAGGAATAATCATCGAGTCTTTTTATTT...

Protein

Download Protein FASTA

380 aa · LXL04_026293|LXL04_026293|OH1004|PROTEIN

MVSADFARNLLGIIGNVISIILFLSTMPTFYRIWKNKSVERFSPIPYLVTFVNCGLWIFYGLPLVHPNSLLVTTTNGAGIIIESFYLILFIIYSDQKKRIRVLLVLLAEIIFLGVLVVLVLNFAHTTKLRSAIVGGISVGGNIMMYASPLSVMKMVITTKSVEYMPFLLSLFCFANGVCWFSYALIRFDPFVAVPNGLGALFGLAQLILYATFYKSTQEIIARRQDKSELVIGNVGTSQVEEEAATSFKTEGTILEKQIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026293`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026293

Location Chr05:124502849-124505315 (+)

Description Similar to SWEET6B: Bidirectional sugar transporter SWEET6b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0605700`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`UniProt: A2WSD3`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os01g0606000`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`UniProt: A2WSD8`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os09g0258700`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026293 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0605700

dosa:Os01g0606000

dosa:Os09g0258700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.741

Rank 1 · LXL04_026293 · OH-1004

Endoplasmic reticulum0.124

Rank 2 · LXL04_026293 · OH-1004

Cytoplasm0.089

Rank 3 · LXL04_026293 · OH-1004

Lysosome / Vacuole0.082

Rank 4 · LXL04_026293 · OH-1004

Golgi apparatus0.047

Rank 5 · LXL04_026293 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083.22MtN3_slv10-98 aa

PF03083.22MtN3_slv133-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026293	`PF03083.22`	MtN3_slv	10	98	4.7e-45	152.3
LXL04_026293	`PF03083.22`	MtN3_slv	133	217	4.7e-45	152.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W0K2`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET6b	57.965%	Swiss-Prot	moderate database homology
`A2WSD3`	Oryza sativa subsp. indica	Bidirectional sugar transporter SWEET6b	56.637%	Swiss-Prot	moderate database homology
`Q8LR09`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET6a	56.637%	Swiss-Prot	moderate database homology
`A2WSD8`	Oryza sativa subsp. indica	Bidirectional sugar transporter SWEET6a	56.637%	Swiss-Prot	moderate database homology
`Q0J349`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET7b	54.825%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card