LXL04_026200 | RubberDandelionOmics

Gene overview

LXL04_026200

Reference: OH-1004 Chr: Chr05 Coordinates: 122680830-122682338 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1107 bp · LXL04_026200|LXL04_026200|OH1004|cDNA

ATGATGAAATGTTTGAGTATATTTCACTCGAAATCCGCCGGAGAAAAGTCTTCATCGGAGCCAAAAGACGAAAACCGACCAAGTAAGTCAAAATCAGCAACATCGTCAGTCAAGTCAGCAGGCTCAGTCTCTTCTTCCCCAAGAAGCATACCCGAAATCTACAAAGAAAAAGAACACACCTTGAAGAAATTTTCATTTTCAGATCTCAGGAATGCTACCAGTAATTTCAACAAGCTTTTAAAAATCGGGGAAGGTGGGTT...

CDS

Download CDS FASTA

1107 bp · LXL04_026200|LXL04_026200|OH1004|CDS

ATGATGAAATGTTTGAGTATATTTCACTCGAAATCCGCCGGAGAAAAGTCTTCATCGGAGCCAAAAGACGAAAACCGACCAAGTAAGTCAAAATCAGCAACATCGTCAGTCAAGTCAGCAGGCTCAGTCTCTTCTTCCCCAAGAAGCATACCCGAAATCTACAAAGAAAAAGAACACACCTTGAAGAAATTTTCATTTTCAGATCTCAGGAATGCTACCAGTAATTTCAACAAGCTTTTAAAAATCGGGGAAGGTGGGTT...

Protein

Download Protein FASTA

368 aa · LXL04_026200|LXL04_026200|OH1004|PROTEIN

MMKCLSIFHSKSAGEKSSSEPKDENRPSKSKSATSSVKSAGSVSSSPRSIPEIYKEKEHTLKKFSFSDLRNATSNFNKLLKIGEGGFGSVYKARIRLSETQIDPIVVAIKRLNKQGMQGHKEWQTEVQFLGVVDHRNLVKLLGYCSVDGDRMQRLLVYEYMPNKSLAVHLFSSTLPPLSWNTRLQICLGAAEGLAYLHEGLETQVIFRDFKTSNVLLDEKFNAKLSDFGLAREGPQGDRTHVSTMPVGTYGYAAPEYIET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026200`
TK1151 ID	TkA06G021620
OH-1004 ID	LXL04_026200
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026200

Location Chr05:122680830-122682338 (-)

Description Similar to PBL19: Probable serine/threonine-protein kinase PBL19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47070`	May be involved in plant defense signaling.	No verified direct reference in this release
`At4g17660`	May be involved in plant defense signaling.	No verified direct reference in this release
`At3g09830`	Involved in the activation of early immune responses.	The receptor-like cytoplasmic kinase PCRK1 contributes to pattern-triggered immunity against Pseudomonas syringae in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13345 Functional characterization of PCRK1, a putative protein kinase with a role in immunity.2015 · DOI: 10.1080/15592324.2015.1063759
`At5g03320`	Functions redundantly with PCRK1 in basal resistance against bacterial pathogens and in regulation of plant immunity.	No verified direct reference in this release
`At2g28930`	Possible bi-functional kinase.	Light-induced stomatal opening is affected by the guard cell protein kinase APK1b.2014 · DOI: 10.1371/journal.pone.0097161

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026200 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0080142 regulation of salicylic acid biosynthetic process Biological Process

GO:1902458 positive regulation of stomatal opening Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT2G28930

ath:AT3G09830

ath:AT4G17660

ath:AT5G03320

ath:AT5G47070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.676

Rank 1 · LXL04_026200 · OH-1004

Cytoplasm0.258

Rank 2 · LXL04_026200 · OH-1004

Nucleus0.215

Rank 3 · LXL04_026200 · OH-1004

Endoplasmic reticulum0.042

Rank 4 · LXL04_026200 · OH-1004

Golgi apparatus0.030

Rank 5 · LXL04_026200 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase77-354 aa

PF07714.24PK_Tyr_Ser-Thr81-355 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026200	`PF00069.32`	Pkinase	77	354	1.1e-46	160.1
LXL04_026200	`PF07714.24`	PK_Tyr_Ser-Thr	81	355	1.9e-47	162.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTC0`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL19	53.684%	Swiss-Prot	strong database homology
`F4JPX3`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL20	51.706%	Swiss-Prot	strong database homology
`Q9SF86`	Arabidopsis thaliana	Serine/threonine-protein kinase PCRK1	52.819%	Swiss-Prot	strong database homology
`Q9LZF8`	Arabidopsis thaliana	Serine/threonine-protein kinase PCRK2	48.257%	Swiss-Prot	moderate database homology
`P46573`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL10	51.818%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card