LXL04_023421 | RubberDandelionOmics

Gene overview

LXL04_023421

Reference: OH-1004 Chr: Chr05 Coordinates: 39426240-39438350 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2688 bp · LXL04_023421|LXL04_023421|OH1004|cDNA

ATGCCCTGCACTTTCCCAGCTATATCCCAAATTTCCTCTCTACAACCCATCCGCACTGTCTCCTTCTCCTCCTTATCCCTCAAAACAGCACTTAAAACACCCAAACGAGACTTCAGGATCTTCTCCGACGATGGAGATGCCGGAGGAGACGCAGACGGTGGCGGAGACGGAGACGCAGACGGTGGTGGAGAAGCAGACCGTGACGACATGGACGAAGAAGAAGCAGACGAGAGCGACAACAAGAGAGATTACGACGTCGA...

CDS

Download CDS FASTA

2688 bp · LXL04_023421|LXL04_023421|OH1004|CDS

ATGCCCTGCACTTTCCCAGCTATATCCCAAATTTCCTCTCTACAACCCATCCGCACTGTCTCCTTCTCCTCCTTATCCCTCAAAACAGCACTTAAAACACCCAAACGAGACTTCAGGATCTTCTCCGACGATGGAGATGCCGGAGGAGACGCAGACGGTGGCGGAGACGGAGACGCAGACGGTGGTGGAGAAGCAGACCGTGACGACATGGACGAAGAAGAAGCAGACGAGAGCGACAACAAGAGAGATTACGACGTCGA...

Protein

Download Protein FASTA

895 aa · LXL04_023421|LXL04_023421|OH1004|PROTEIN

MPCTFPAISQISSLQPIRTVSFSSLSLKTALKTPKRDFRIFSDDGDAGGDADGGGDGDADGGGEADRDDMDEEEADESDNKRDYDVEYEALVAASRGGGEDGISMAQSKNFVSTQGWNSEVVVDYRINEDEFHKIKPDTDIYAIPRFLAPMPEKYIRCAKSDWGTYNVTEPPIDALRDPIYKSEWEVMKVFLTKHYRNRRLDDPDFVLDFEEIYVIDSKTKSITRARVLVSKLHLSKRNSSGIRKHDAEKPHQIQSKENT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023421`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023421

Location Chr05:39426240-39438350 (+)

Description Similar to SRG1: Protein SRG1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17020`	Protein SRG1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023421 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0032259 methylation Biological Process

GO:0097295 morphine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0008168 methyltransferase activity Molecular Function

GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor Molecular Function

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0030782 (S)-tetrahydroprotoberberine N-methyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0102802 thebaine 6-O-demethylase activity Molecular Function

KEGG gene cross-reference

ag:ADD85329

ag:ADD85331

ath:AT1G17020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.501

Rank 1 · LXL04_023421 · OH-1004

Nucleus0.309

Rank 2 · LXL04_023421 · OH-1004

Mitochondrion0.115

Rank 3 · LXL04_023421 · OH-1004

Plastid0.114

Rank 4 · LXL04_023421 · OH-1004

Cell membrane0.071

Rank 5 · LXL04_023421 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28675.1PTAC6_N103-135 aa

PF28675.1PTAC6_N136-226 aa

PF14226.13DIOX_N591-699 aa

PF03171.272OG-FeII_Oxy747-846 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023421	`PF28675.1`	PTAC6_N	103	135	1.6e-51	175.0
LXL04_023421	`PF28675.1`	PTAC6_N	136	226	1.6e-51	175.0
LXL04_023421	`PF14226.13`	DIOX_N	591	699	8.4e-28	98.1
LXL04_023421	`PF03171.27`	2OG-FeII_Oxy	747	846	8.6e-33	113.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39224`	Arabidopsis thaliana	Protein SRG1	57.103%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card