LXL04_022333 | RubberDandelionOmics

Gene overview

LXL04_022333

Reference: OH-1004 Chr: Chr04 Coordinates: 148308344-148311087 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · LXL04_022333|LXL04_022333|OH1004|cDNA

ATGGAAACAGCGACCGACAGAGAGAGACACACACACTTACCAGAATCTGTGACGCAGCGAACCCAGGAGGACGAACGACTGAAGAAGCAGAGAAGCAGCGAAGCGGCGAACAGTCCGCATACAAAGTTACAAATTAAACAGATTCATTCTCTTGCTGCTGCCGACAGTTCACACTTCACAGTGAACACAAACAACTTGAATACTGAAATTAACGGCGTCGGTGCTGCAGTGGTGCGAACAGGCTGTGGTGCTGCGGTGGT...

CDS

Download CDS FASTA

1035 bp · LXL04_022333|LXL04_022333|OH1004|CDS

ATGGAAACAGCGACCGACAGAGAGAGACACACACACTTACCAGAATCTGTGACGCAGCGAACCCAGGAGGACGAACGACTGAAGAAGCAGAGAAGCAGCGAAGCGGCGAACAGTCCGCATACAAAGTTACAAATTAAACAGATTCATTCTCTTGCTGCTGCCGACAGTTCACACTTCACAGTGAACACAAACAACTTGAATACTGAAATTAACGGCGTCGGTGCTGCAGTGGTGCGAACAGGCTGTGGTGCTGCGGTGGT...

Protein

Download Protein FASTA

344 aa · LXL04_022333|LXL04_022333|OH1004|PROTEIN

METATDRERHTHLPESVTQRTQEDERLKKQRSSEAANSPHTKLQIKQIHSLAAADSSHFTVNTNNLNTEINGVGAAVVRTGCGAAVVRTGVSAAVVRQGVSDLQRWGLGVQSESESLLVAAMELEDGGGMIDFELNEHNTGTRFRPNPGFYRSIRVLTDPSVFWKIGTRFARSIREQDLNSQIATALCLASVVDGAPDLDPFYLRRMLPRIEKLLKCDSFKAKAALLTFLGSVIGVGVASSPVTVKNLVTILVEFVAKSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022333`
TK1151 ID	TkA05G459180
OH-1004 ID	LXL04_022333
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.800
Protein coverage (%)	TK1151 71.000 / OH-1004 52.616 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022333

Location Chr04:148308344-148311087 (+)

Description Similar to TOR1L3: TORTIFOLIA1-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62580`	TORTIFOLIA1-like protein 3.	No verified direct reference in this release
`At1g27210`	TORTIFOLIA1-like protein 4.	No verified direct reference in this release
`At1g59850`	TORTIFOLIA1-like protein 5.	No verified direct reference in this release
`At2g07170`	TORTIFOLIA1-like protein 2.	No verified direct reference in this release
`At1g50890`	Plant-specific microtubule-associated protein (MAP) that regulates the orientation of cortical microtubules and the direction of organ growth.	Arabidopsis SPIRAL2 promotes uninterrupted microtubule growth by suppressing the pause state of microtubule dynamics.2008 · DOI: 10.1242/jcs.030221

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022333 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0010031 circumnutation Biological Process

GO:0170002 halotropism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010005 cortical microtubule, transverse to long axis Cellular Component

GO:0055028 cortical microtubule Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G27210

ath:AT1G50890

ath:AT1G59850

ath:AT2G07170

ath:AT5G62580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.475

Rank 1 · LXL04_022333 · OH-1004

Nucleus0.435

Rank 2 · LXL04_022333 · OH-1004

Cell membrane0.097

Rank 3 · LXL04_022333 · OH-1004

Mitochondrion0.072

Rank 4 · LXL04_022333 · OH-1004

Endoplasmic reticulum0.070

Rank 5 · LXL04_022333 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24714.2TOR1L1_N170-317 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022333	`PF24714.2`	TOR1L1_N	170	317	2.5e-49	168.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPR6`	Arabidopsis thaliana	TORTIFOLIA1-like protein 3	51.190%	Swiss-Prot	weak database homology
`Q93ZH1`	Arabidopsis thaliana	TORTIFOLIA1-like protein 4	46.784%	Swiss-Prot	weak database homology
`Q9XIE4`	Arabidopsis thaliana	TORTIFOLIA1-like protein 5	43.919%	Swiss-Prot	weak database homology
`F4IK92`	Arabidopsis thaliana	TORTIFOLIA1-like protein 2	30.818%	Swiss-Prot	weak database homology
`F4I6M4`	Arabidopsis thaliana	TORTIFOLIA1-like protein 1	29.932%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card