RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_021616
Reference: OH-1004 Chr: Chr04 Coordinates: 133645963-133647444 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1017 bp · LXL04_021616|LXL04_021616|OH1004|cDNA

ATGGATCACAAACGAATCGTTCATGAGTTGACTCAAGGTAAGGAATTTGCTGAGCAACTCAAGATTCATCTCAAGAACCCTTCATCTTCCCATGAAACCCAAGAAATCTTGATCCATAACATCCTCAATTCGTACGAAAATACGTTATCTTTACTCGCCATTTGTGGGCTTACTACACATGGAAGCAATGATGAGCCACATTTGCATGGTGAAAAGGGAATCACAAATTTGGAATCACAAGTTTCATTGACCGAAAGCCC...

CDS

Download CDS FASTA

1017 bp · LXL04_021616|LXL04_021616|OH1004|CDS

ATGGATCACAAACGAATCGTTCATGAGTTGACTCAAGGTAAGGAATTTGCTGAGCAACTCAAGATTCATCTCAAGAACCCTTCATCTTCCCATGAAACCCAAGAAATCTTGATCCATAACATCCTCAATTCGTACGAAAATACGTTATCTTTACTCGCCATTTGTGGGCTTACTACACATGGAAGCAATGATGAGCCACATTTGCATGGTGAAAAGGGAATCACAAATTTGGAATCACAAGTTTCATTGACCGAAAGCCC...

Protein

Download Protein FASTA

338 aa · LXL04_021616|LXL04_021616|OH1004|PROTEIN

MDHKRIVHELTQGKEFAEQLKIHLKNPSSSHETQEILIHNILNSYENTLSLLAICGLTTHGSNDEPHLHGEKGITNLESQVSLTESPHSEDSDPVFQDIHHKDSGAKRKSKDGLEKWKKQVKVRGDMVFEEALDDGYSWRKYGQKDVLGAKHPRGYYRCTYRQLQGCLATKQVQRTNDDPNIFNMTYHGNHTCHPKNDTCSSLPSPSSLSPPSEIQHAPPQNQLLESPKIIQTFQAEYCKSINENLENPLLHFPSTSNNN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_021616
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_021616
LocationChr04:133645963-133647444 (+)
DescriptionSimilar to WRKY41: Probable WRKY transcription factor 41
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g11070 Transcription factor. No verified direct reference in this release
At5g24110 Transcription factor. No verified direct reference in this release
At4g23810 Transcription factor.
The antagonist function of Arabidopsis WRKY53 and ESR/ESP in leaf senescence is modulated by the jasmonic and salicylic acid equilibrium.2007 · DOI: 10.1105/tpc.106.042705
A HECT E3 ubiquitin ligase negatively regulates Arabidopsis leaf senescence through degradation of the transcription factor WRKY53.2010 · DOI: 10.1111/j.1365-313x.2010.04233.x
Arabidopsis WRKY46 coordinates with WRKY70 and WRKY53 in basal resistance against pathogen Pseudomonas syringae.2012 · DOI: 10.1016/j.plantsci.2011.12.003
At2g46400 Transcription factor involved in the regulation of osmotic stress responses and stomatal movement.
EDS1 contributes to nonhost resistance of Arabidopsis thaliana against Erwinia amylovora.2012 · DOI: 10.1094/mpmi-05-11-0111
Arabidopsis WRKY46 coordinates with WRKY70 and WRKY53 in basal resistance against pathogen Pseudomonas syringae.2012 · DOI: 10.1016/j.plantsci.2011.12.003
Transcription factor WRKY46 regulates osmotic stress responses and stomatal movement independently in Arabidopsis.2014 · DOI: 10.1111/tpj.12538
Arabidopsis WRKY46, WRKY54, and WRKY70 Transcription Factors Are Involved in Brassinosteroid-Regulated Plant Growth and Drought Responses.2017 · DOI: 10.1105/tpc.17.00364

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0571200 May play a role in defense responses.
The bHLH Rac Immunity1 (RAI1) Is Activated by OsRac1 via OsMAPK3 and OsMAPK6 in Rice Immunity.2012 · DOI: 10.1093/pcp/pcs033
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021616 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006952 defense response Biological Process
GO:0009409 response to cold Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0010150 leaf senescence Biological Process
GO:0010193 response to ozone Biological Process
GO:0031347 regulation of defense response Biological Process
GO:0033198 response to ATP Biological Process
GO:0042542 response to hydrogen peroxide Biological Process
KEGG gene cross-reference
ath:AT2G46400
ath:AT4G11070
ath:AT4G23810
ath:AT5G24110
dosa:Os05g0571200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.909
Rank 1 · LXL04_021616 · OH-1004
Cytoplasm0.229
Rank 2 · LXL04_021616 · OH-1004
Mitochondrion0.024
Rank 3 · LXL04_021616 · OH-1004
Cell membrane0.018
Rank 4 · LXL04_021616 · OH-1004
Endoplasmic reticulum0.011
Rank 5 · LXL04_021616 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106.22WRKY134-194 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_021616PF03106.22WRKY1341942.2e-2692.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8H0Y8Arabidopsis thalianaProbable WRKY transcription factor 4139.409%Swiss-Protmoderate database homology
Q9FL62Arabidopsis thalianaProbable WRKY transcription factor 3031.159%Swiss-Protmoderate database homology
Q9SUP6Arabidopsis thalianaProbable WRKY transcription factor 5333.617%Swiss-Protmoderate database homology
Q9SKD9Arabidopsis thalianaProbable WRKY transcription factor 4636.410%Swiss-Protmoderate database homology
Q0DFT7Oryza sativa subsp. japonicaTranscription factor WRKY1938.333%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser