LXL04_017259 | RubberDandelionOmics

Gene overview

LXL04_017259

Reference: OH-1004 Chr: Chr03 Coordinates: 144510773-144512827 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

966 bp · LXL04_017259|LXL04_017259|OH1004|cDNA

ATGGAGATTTCACATTTCAGAAACTTATCAGGACTAACAGGAATAGAAGATTCCTCTTTCAATTTTCAATGTCCACTCAATTCCTTCGATAATCAACTAGATTCAATGGCGTTTGGAGACAACGTCGATCACATTCAAGGTCATGCAGGTGTGTTTGACTTTGACTATTACAAACCTGTAATCGAACCATCTTCAAGGCCAAGTAAACAGATCAAAACAGACAGCTGGAATTCATCCACAACAACCGATCATTCGTATCT...

CDS

Download CDS FASTA

966 bp · LXL04_017259|LXL04_017259|OH1004|CDS

ATGGAGATTTCACATTTCAGAAACTTATCAGGACTAACAGGAATAGAAGATTCCTCTTTCAATTTTCAATGTCCACTCAATTCCTTCGATAATCAACTAGATTCAATGGCGTTTGGAGACAACGTCGATCACATTCAAGGTCATGCAGGTGTGTTTGACTTTGACTATTACAAACCTGTAATCGAACCATCTTCAAGGCCAAGTAAACAGATCAAAACAGACAGCTGGAATTCATCCACAACAACCGATCATTCGTATCT...

Protein

Download Protein FASTA

321 aa · LXL04_017259|LXL04_017259|OH1004|PROTEIN

MEISHFRNLSGLTGIEDSSFNFQCPLNSFDNQLDSMAFGDNVDHIQGHAGVFDFDYYKPVIEPSSRPSKQIKTDSWNSSTTTDHSYLNLTHQNTLVTPKEEMTVSSKSRNGFIYEKNLGFVNGVHGGLDVAKKDVKFSTPAQDHILAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKHMKTLQEKVKTLEDQIKKRPNTESVFFVKRYEVLDDVNRSSSNENLGGGPVHDQLPEIEARFFGNDVLIKIHCEKKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017259`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017259

Location Chr03:144510773-144512827 (-)

Description Similar to BHLH25: Transcription factor bHLH25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37850`	Transcription factor bHLH25.	No verified direct reference in this release
`At2g22760`	Transcription factor bHLH19.	No verified direct reference in this release
`At2g22750`	Transcription factor bHLH18.	No verified direct reference in this release
`At2g22770`	Transcription activator that regulates the expression of at least NAI2, PYK10 and PBP1.	A novel ER-derived compartment, the ER body, selectively accumulates a beta-glucosidase with an ER-retention signal in Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01636.x NAI1 gene encodes a basic-helix-loop-helix-type putative transcription factor that regulates the formation of an endoplasmic reticulum-derived structure, the ER body.2004 · DOI: 10.1105/tpc.021154 Activation of an ER-body-localized beta-glucosidase via a cytosolic binding partner in damaged tissues of Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci126 PYK10, a beta-glucosidase located in the endoplasmatic reticulum, is crucial for the beneficial interaction between Arabidopsis thaliana and the endophytic fungus Piriformospora indica.2008 · DOI: 10.1111/j.1365-313x.2008.03424.x Antagonistic jacalin-related lectins regulate the size of ER body-type beta-glucosidase complexes in Arabidopsis thaliana.2008 · DOI: 10.1093/pcp/pcn075 NAI2 is an endoplasmic reticulum body component that enables ER body formation in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.108.059345
`At5g57150`	Transcription factor bHLH35.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017259 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G22750

ath:AT2G22760

ath:AT2G22770

ath:AT4G37850

ath:AT5G57150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · LXL04_017259 · OH-1004

Cytoplasm0.096

Rank 2 · LXL04_017259 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_017259 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_017259 · OH-1004

Plastid0.010

Rank 5 · LXL04_017259 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010.32HLH144-189 aa

PF23177.2bHLH_IRO3147-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017259	`PF00010.32`	HLH	144	189	3e-10	40.5
LXL04_017259	`PF23177.2`	bHLH_IRO3	147	201	1.1e-08	36.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T072`	Arabidopsis thaliana	Transcription factor bHLH25	47.541%	Swiss-Prot	moderate database homology
`Q1PF16`	Arabidopsis thaliana	Transcription factor bHLH19	50.820%	Swiss-Prot	moderate database homology
`Q1PF17`	Arabidopsis thaliana	Transcription factor bHLH18	53.552%	Swiss-Prot	moderate database homology
`Q8S3F1`	Arabidopsis thaliana	Transcription factor NAI1	42.553%	Swiss-Prot	moderate database homology
`Q2HIV9`	Arabidopsis thaliana	Transcription factor bHLH35	28.729%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card