LXL04_016971 | RubberDandelionOmics

Gene overview

LXL04_016971

Reference: OH-1004 Chr: Chr03 Coordinates: 138165008-138168649 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2100 bp · LXL04_016971|LXL04_016971|OH1004|cDNA

ATGGCTTCATCAACAGCTCAGATTCACGCTCTCGGAGGCACTCCCTTTGCTTCAACTAAATCTTCACCCAAAACCGTCTTCTTCGGTAAAGGATTAACCAAATCCGTATCCTTTTCGCACCAGAAATCATTCGTCAAGCTCAAGAAGACAAGAAGAAGTGGTCCGCTTAGAGTTGTGGCTGAGAAGGTTGTTGGAATCGATCTAGGAACCACAAACTCCGCCGTCGGTGCCATGGAAGGTGGGAAGCCTGTTATTGTGAC...

CDS

Download CDS FASTA

2100 bp · LXL04_016971|LXL04_016971|OH1004|CDS

ATGGCTTCATCAACAGCTCAGATTCACGCTCTCGGAGGCACTCCCTTTGCTTCAACTAAATCTTCACCCAAAACCGTCTTCTTCGGTAAAGGATTAACCAAATCCGTATCCTTTTCGCACCAGAAATCATTCGTCAAGCTCAAGAAGACAAGAAGAAGTGGTCCGCTTAGAGTTGTGGCTGAGAAGGTTGTTGGAATCGATCTAGGAACCACAAACTCCGCCGTCGGTGCCATGGAAGGTGGGAAGCCTGTTATTGTGAC...

Protein

Download Protein FASTA

699 aa · LXL04_016971|LXL04_016971|OH1004|PROTEIN

MASSTAQIHALGGTPFASTKSSPKTVFFGKGLTKSVSFSHQKSFVKLKKTRRSGPLRVVAEKVVGIDLGTTNSAVGAMEGGKPVIVTNAEGQRTTPSVVAYTKNGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMSEVDEESKQVSYTVVRDENGNVKLDCPAIGKQFAAEEISAQVLRKLVDDASKFLNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFERKNNETILVFDLGGGTFDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016971`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016971

Location Chr03:138165008-138168649 (-)

Description Similar to HSP70: Stromal 70 kDa heat shock-related protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49910`	Acts redundantly with HSP70-6 in the thermotolerance of germinating seeds.	Arabidopsis stromal 70-kD heat shock proteins are essential for plant development and important for thermotolerance of germinating seeds.2008 · DOI: 10.1104/pp.107.114496 Stromal Hsp70 is important for protein translocation into pea and Arabidopsis chloroplasts.2010 · DOI: 10.1105/tpc.109.071415 Arabidopsis stromal 70-kDa heat shock proteins are essential for chloroplast development.2010 · DOI: 10.1007/s00425-010-1192-z
`At4g24280`	Acts redundantly with HSP70-7 in the thermotolerance of germinating seeds.	Arabidopsis stromal 70-kD heat shock proteins are essential for plant development and important for thermotolerance of germinating seeds.2008 · DOI: 10.1104/pp.107.114496 Stromal Hsp70 is important for protein translocation into pea and Arabidopsis chloroplasts.2010 · DOI: 10.1105/tpc.109.071415 Arabidopsis stromal 70-kDa heat shock proteins are essential for chloroplast development.2010 · DOI: 10.1007/s00425-010-1192-z

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016971 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0015031 protein transport Biological Process

GO:0042026 protein refolding Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009532 plastid stroma Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT4G24280

ath:AT5G49910

syn:sll0170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.971

Rank 1 · LXL04_016971 · OH-1004

Mitochondrion0.047

Rank 2 · LXL04_016971 · OH-1004

Cytoplasm0.022

Rank 3 · LXL04_016971 · OH-1004

Peroxisome0.014

Rank 4 · LXL04_016971 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_016971 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012.27HSP7063-657 aa

PF06723.20MreB_Mbl173-430 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016971	`PF00012.27`	HSP70	63	657	4.6e-264	877.9
LXL04_016971	`PF06723.20`	MreB_Mbl	173	430	5e-18	65.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTX9`	Arabidopsis thaliana	Heat shock 70 kDa protein 7, chloroplastic	82.410%	Swiss-Prot	strong database homology
`Q9STW6`	Arabidopsis thaliana	Heat shock 70 kDa protein 6, chloroplastic	85.862%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card