LXL04_015005 | RubberDandelionOmics

Gene overview

LXL04_015005

Reference: OH-1004 Chr: Chr03 Coordinates: 61333915-61336976 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1345 bp · LXL04_015005|LXL04_015005|OH1004|cDNA

AAACACAATCTAATACGTAGTATTACAAAATAAAAATTGTCGAATAACAGGAACAGAAGTCCAAAACCACGAAGGGTTTTTCATTCTGAGCCTTCAAAGCAGCCGTAAAAGGAGAAAAAAGAGGATTACATCAATGGAGAAAGAGAACCAGACGAAAGCAGagcaagaacaagaacaagtACAAGACCAAGTCGTGAATCCATGGGAAGTATCGGCTAAAGGCAAGATTGATTACGACAAACTAATTGACCAATTTGGTT...

CDS

Download CDS FASTA

1260 bp · LXL04_015005|LXL04_015005|OH1004|CDS

CTGAGCCTTCAAAGCAGCCGTAAAAGGAGAAAAAAGAGGATTACATCAATGGAGAAAGAGAACCAGACGAAAGCAGAGCAAGAACAAGAACAAGTACAAGACCAAGTCGTGAATCCATGGGAAGTATCGGCTAAAGGCAAGATTGATTACGACAAACTAATTGACCAATTTGGTTGTCAAAGGCTCGACCAATCCTTTGTTGATCGAGTTTTTCGCCTCACTTCTCGTACTCCTCATGTCTTCCTCCGCCGTAACGTTTT...

Protein

Download Protein FASTA

419 aa · LXL04_015005|LXL04_015005|OH1004|PROTEIN

MSLQSSRKRRKKRITSMEKENQTKAEQEQEQVQDQVVNPWEVSAKGKIDYDKLIDQFGCQRLDQSFVDRVFRLTSRTPHVFLRRNVFFAHRDFNEILDGYERGEKFYLYTGRGPSSEALHLGHLVPFMFTKYLQEAFKVPLVIQLTDDEKCMWKNLTVEESKRLARENAKDIIACGFDVSRTFIFSDFDYVGGAFYENMIKVAKCVTYNKVVGIFGFSGEDHIGKISFPPVQAVPSFPSSFPHLFPGKDKLRCLIPCAID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015005`
TK1151 ID	TkA02G378160
OH-1004 ID	LXL04_015005
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 94.157 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015005

Location Chr03:61333915-61336976 (-)

Description Similar to At3g04600: Tryptophan--tRNA ligase, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04600`	Tryptophan--tRNA ligase, cytoplasmic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015005 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006436 tryptophanyl-tRNA aminoacylation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0004830 tryptophan-tRNA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT3G04600

dre:393745

hsa:7453

ocu:100009123

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.446

Rank 1 · LXL04_015005 · OH-1004

Nucleus0.340

Rank 2 · LXL04_015005 · OH-1004

Mitochondrion0.178

Rank 3 · LXL04_015005 · OH-1004

Plastid0.066

Rank 4 · LXL04_015005 · OH-1004

Peroxisome0.045

Rank 5 · LXL04_015005 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00579.32tRNA-synt_1b103-389 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015005	`PF00579.32`	tRNA-synt_1b	103	389	8.4e-22	78.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SR15`	Arabidopsis thaliana	Tryptophan--tRNA ligase, cytoplasmic	86.146%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card