LXL04_014873 | RubberDandelionOmics

Gene overview

LXL04_014873

Reference: OH-1004 Chr: Chr03 Coordinates: 58457141-58458473 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

696 bp · LXL04_014873|LXL04_014873|OH1004|cDNA

ATGGAGTGGAATAGCAGTAGCCCTATACCTTTTGTACCTCGACCTTCACAAAGTTCCTTTGCCTTTCTTTATAACTATAACACCGACCCCTATCTATACCCACCTGGGGCAGAGATGAAGCATCAGATGATGCTGCAGGGGTCTTTACCAATGATGGATATCAACCAAATTGATTACGATAGCAACAATCCCGATAAAAAGAAAAGATTGACAAGTGAGCAACTAGAGGCGTTGGAAAACAGTTTTCAGGAGGACATTAA...

CDS

Download CDS FASTA

696 bp · LXL04_014873|LXL04_014873|OH1004|CDS

ATGGAGTGGAATAGCAGTAGCCCTATACCTTTTGTACCTCGACCTTCACAAAGTTCCTTTGCCTTTCTTTATAACTATAACACCGACCCCTATCTATACCCACCTGGGGCAGAGATGAAGCATCAGATGATGCTGCAGGGGTCTTTACCAATGATGGATATCAACCAAATTGATTACGATAGCAACAATCCCGATAAAAAGAAAAGATTGACAAGTGAGCAACTAGAGGCGTTGGAAAACAGTTTTCAGGAGGACATTAA...

Protein

Download Protein FASTA

231 aa · LXL04_014873|LXL04_014873|OH1004|PROTEIN

MEWNSSSPIPFVPRPSQSSFAFLYNYNTDPYLYPPGAEMKHQMMLQGSLPMMDINQIDYDSNNPDKKKRLTSEQLEALENSFQEDIKLDPERKMKLSNELGLQPRQISVWFQNRRARWKGKQLERLYDALKQEFDAVFREKQKLQDEVLALRTIIKEHGSNTQAGVSTRGYSDMTGEETTVESASVNTIRSSNNHSYQGVATPASAVAGGDCNYMVNYADQAAVATPFCWE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014873`
TK1151 ID	TkA02G387570
OH-1004 ID	LXL04_014873
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014873

Location Chr03:58457141-58458473 (-)

Description Similar to ATHB-51: Putative homeobox-leucine zipper protein ATHB-51

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03790`	Putative transcription factor.	No verified direct reference in this release
`At2g36610`	Probable transcription factor.	No verified direct reference in this release
`At5g65310`	Probable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0729700`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2X980`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014873 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010434 bract formation Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G36610

ath:AT5G03790

ath:AT5G65310

dosa:Os02g0729700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980

Rank 1 · LXL04_014873 · OH-1004

Cytoplasm0.082

Rank 2 · LXL04_014873 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_014873 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_014873 · OH-1004

Plastid0.011

Rank 5 · LXL04_014873 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain66-119 aa

PF02183.24HALZ121-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014873	`PF00046.36`	Homeodomain	66	119	5.7e-19	68.4
LXL04_014873	`PF02183.24`	HALZ	121	153	2.9e-07	31.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZR0`	Arabidopsis thaliana	Putative homeobox-leucine zipper protein ATHB-51	49.746%	Swiss-Prot	moderate database homology
`Q4PSR7`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-22	63.107%	Swiss-Prot	weak database homology
`P46667`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-5	45.946%	Swiss-Prot	moderate database homology
`Q6YWR4`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX16	50.000%	Swiss-Prot	weak database homology
`A2X980`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX16	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card