LXL04_014008 | RubberDandelionOmics

Gene overview

LXL04_014008

Reference: OH-1004 Chr: Chr03 Coordinates: 40453055-40455304 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2250 bp · LXL04_014008|LXL04_014008|OH1004|cDNA

ATGTCCGGTAATCTTCCTAATGAGACTAATTTGTCACAGGTTATAACAAACAGTGAAAACATGACCGAAAAAGTTTATGAAGAGCTACACAATGCAAAAGCAGAAATCGAAAAGCTGAGATCAGAATACCATGAAAAATCCAGTCTCTGTAACAACTTGAAAAGATCACATGATGATCAAGTCAAAAAAATCCAAGAACTCAATCTGAAACTCGAGAAACAGCATCAAGAAACAGAATTAAAGACTGATGAAATCTATGC...

CDS

Download CDS FASTA

2250 bp · LXL04_014008|LXL04_014008|OH1004|CDS

ATGTCCGGTAATCTTCCTAATGAGACTAATTTGTCACAGGTTATAACAAACAGTGAAAACATGACCGAAAAAGTTTATGAAGAGCTACACAATGCAAAAGCAGAAATCGAAAAGCTGAGATCAGAATACCATGAAAAATCCAGTCTCTGTAACAACTTGAAAAGATCACATGATGATCAAGTCAAAAAAATCCAAGAACTCAATCTGAAACTCGAGAAACAGCATCAAGAAACAGAATTAAAGACTGATGAAATCTATGC...

Protein

Download Protein FASTA

749 aa · LXL04_014008|LXL04_014008|OH1004|PROTEIN

MSGNLPNETNLSQVITNSENMTEKVYEELHNAKAEIEKLRSEYHEKSSLCNNLKRSHDDQVKKIQELNLKLEKQHQETELKTDEIYAANQSLKDLECKLKEKENIIKSFTSMNDKLRVDFNSKLQESEEEKTNILCLLDEANMKIQELEQKNRDFMDKIEVLKEGIVSVSQKKCASESKVAKASKQMRERGDLFEKLEEEKVNLEEQIKWKNEQFKHLEEAHEKIRNKLRIKEKEWDMEKSSFFDEISTLETKLDSQITL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014008`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014008

Location Chr03:40453055-40455304 (-)

Description Similar to At4g38062: Uncharacterized protein At4g38062

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38062`	Uncharacterized protein At4g38062.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014008 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT4G38062

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.609

Rank 1 · LXL04_014008 · OH-1004

Nucleus0.320

Rank 2 · LXL04_014008 · OH-1004

Cell membrane0.092

Rank 3 · LXL04_014008 · OH-1004

Golgi apparatus0.043

Rank 4 · LXL04_014008 · OH-1004

Mitochondrion0.039

Rank 5 · LXL04_014008 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30964.1At4g38062_N35-283 aa

PF30964.1At4g38062_N280-371 aa

PF30964.1At4g38062_N377-473 aa

PF30966.1At4g38062_C501-591 aa

PF30966.1At4g38062_C583-668 aa

PF30966.1At4g38062_C665-710 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014008	`PF30964.1`	At4g38062_N	35	283	1.2e-107	361.0
LXL04_014008	`PF30964.1`	At4g38062_N	280	371	1.2e-107	361.0
LXL04_014008	`PF30964.1`	At4g38062_N	377	473	1.2e-107	361.0
LXL04_014008	`PF30966.1`	At4g38062_C	501	591	7.6e-29	101.7
LXL04_014008	`PF30966.1`	At4g38062_C	583	668	7.6e-29	101.7
LXL04_014008	`PF30966.1`	At4g38062_C	665	710	7.6e-29	101.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0CB23`	Arabidopsis thaliana	Uncharacterized protein At4g38062	36.611%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card