LXL04_013477 | RubberDandelionOmics

Gene overview

LXL04_013477

Reference: OH-1004 Chr: Chr03 Coordinates: 30188227-30190076 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1038 bp · LXL04_013477|LXL04_013477|OH1004|cDNA

ATGGCGTTCAAGCAAAGCATAGTTCAGCGGATGTTCAACATCTGCAATAACAAATTCTCCAACCAGACGTTACGGAACTGCCGCATTTCTCCGTCATCCGCCGCTTCTCAAGTTTTCATGCCACCTAATCTCGATAAGGTGGCGCCAGATCCGGGAGACGAGACGCTTTTCCGGAGGTTTCTCCTACGGCGGCCGTTGGACTTATCGTCCTCCTCCATGCCGGATATCTTCCGAGCGAGAGGCGACAGCATGTTGGAGAA...

CDS

Download CDS FASTA

1038 bp · LXL04_013477|LXL04_013477|OH1004|CDS

ATGGCGTTCAAGCAAAGCATAGTTCAGCGGATGTTCAACATCTGCAATAACAAATTCTCCAACCAGACGTTACGGAACTGCCGCATTTCTCCGTCATCCGCCGCTTCTCAAGTTTTCATGCCACCTAATCTCGATAAGGTGGCGCCAGATCCGGGAGACGAGACGCTTTTCCGGAGGTTTCTCCTACGGCGGCCGTTGGACTTATCGTCCTCCTCCATGCCGGATATCTTCCGAGCGAGAGGCGACAGCATGTTGGAGAA...

Protein

Download Protein FASTA

345 aa · LXL04_013477|LXL04_013477|OH1004|PROTEIN

MAFKQSIVQRMFNICNNKFSNQTLRNCRISPSSAASQVFMPPNLDKVAPDPGDETLFRRFLLRRPLDLSSSSMPDIFRARGDSMLEKLKEMDITRGRIRLDVLSPPLERSSEGELTVAQAKKILRVSQIERLKSKLRSSCKNHVSYDEFVEICIEGCSNRDQGLDLAKALDDSGSVIVLGNVVFLKPEQVVKAISELLPTNQPATSNPKVQELEEMEKWKSAIDAKAKTMVQRELWGGLAYLMVQTAGFMRLTFWELSWD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013477`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013477

Location Chr03:30188227-30190076 (+)

Description Similar to At2g23790: Calcium uniporter protein 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23790`	Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria (By similarity).	No verified direct reference in this release
`At4g36820`	Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria (By similarity).	No verified direct reference in this release
`At5g66650`	Chloroplastic membrane calcium uniporter that mediates calcium uptake into chloroplast stroma.	No verified direct reference in this release
`At5g42610`	Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria (By similarity).	No verified direct reference in this release
`At1g57610`	Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013477 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0036444 calcium import into the mitochondrion Biological Process

GO:0051560 mitochondrial calcium ion homeostasis Biological Process

GO:0070509 calcium ion import Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:1990246 uniplex complex Cellular Component

GO:0005262 calcium channel activity Molecular Function

GO:0015292 uniporter activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G57610

ath:AT2G23790

ath:AT4G36820

ath:AT5G42610

ath:AT5G66650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.863

Rank 1 · LXL04_013477 · OH-1004

Plastid0.078

Rank 2 · LXL04_013477 · OH-1004

Nucleus0.072

Rank 3 · LXL04_013477 · OH-1004

Cytoplasm0.058

Rank 4 · LXL04_013477 · OH-1004

Cell membrane0.022

Rank 5 · LXL04_013477 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04678.19MCU161-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013477	`PF04678.19`	MCU	161	319	2.1e-54	185.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64823`	Arabidopsis thaliana	Calcium uniporter protein 3, mitochondrial	52.537%	Swiss-Prot	strong database homology
`Q1PE15`	Arabidopsis thaliana	Calcium uniporter protein 4, mitochondrial	48.485%	Swiss-Prot	moderate database homology
`Q9LVR5`	Arabidopsis thaliana	Chloroplastic calcium uniporter protein	45.921%	Swiss-Prot	moderate database homology
`Q9FJV7`	Arabidopsis thaliana	Calcium uniporter protein 5, mitochondrial	50.216%	Swiss-Prot	moderate database homology
`Q8VYR0`	Arabidopsis thaliana	Calcium uniporter protein 2, mitochondrial	36.073%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card