LXL04_012218 | RubberDandelionOmics

Gene overview

LXL04_012218

Reference: OH-1004 Chr: Chr03 Coordinates: 8538224-8538985 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · LXL04_012218|LXL04_012218|OH1004|cDNA

ATGGCGACATCCGACGACGGTGCTGCTGCCGGAGAAGTTAGCAAGATCAAGGGATCCTGGAGCCCCCAAGAGGACGCCACCCTCATCAAACTGGTCGAACAACATGGTCCGCGCAACTGGTCCCTCATCAGTTCCCGAATTCCAGGCCGATCTGGAAAATCCTGCCGTCTACGGTGGTGCAACCAGCTCAGCCCAGACGTCGAGCACCGTCCCTTTACTCGTGAAGAGGATGACGTCATCGTCCGAGCACATGCCATCCA...

CDS

Download CDS FASTA

762 bp · LXL04_012218|LXL04_012218|OH1004|CDS

ATGGCGACATCCGACGACGGTGCTGCTGCCGGAGAAGTTAGCAAGATCAAGGGATCCTGGAGCCCCCAAGAGGACGCCACCCTCATCAAACTGGTCGAACAACATGGTCCGCGCAACTGGTCCCTCATCAGTTCCCGAATTCCAGGCCGATCTGGAAAATCCTGCCGTCTACGGTGGTGCAACCAGCTCAGCCCAGACGTCGAGCACCGTCCCTTTACTCGTGAAGAGGATGACGTCATCGTCCGAGCACATGCCATCCA...

Protein

Download Protein FASTA

253 aa · LXL04_012218|LXL04_012218|OH1004|PROTEIN

MATSDDGAAAGEVSKIKGSWSPQEDATLIKLVEQHGPRNWSLISSRIPGRSGKSCRLRWCNQLSPDVEHRPFTREEDDVIVRAHAIHGNKWSTISRLLPGRTDNAIKNHWNSTLRRRGVSGSGSGEVSLLSNSGVVKRHVTDGSSESTQSDPVLKKQCSRNSDRSSCDGPPTVLTLLPPGEIKAVEQVTEKNEEVDDDVEEKSTVEMDNTCLVTIMKRMIAEEVRIYINELRAKEGLNLISGPHSQHLPQNRD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012218`
TK1151 ID	TkA02G580800
OH-1004 ID	LXL04_012218
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012218

Location Chr03:8538224-8538985 (-)

Description Similar to MYB73: Transcription factor MYB73

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37260`	Transcription factor that functions in salt stress response.	Loss of the R2R3 MYB, AtMyb73, causes hyper-induction of the SOS1 and SOS3 genes in response to high salinity in Arabidopsis.2013 · DOI: 10.1016/j.jplph.2013.05.011
`At5g67300`	Transcription factor.	Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis.2008 · DOI: 10.1104/pp.107.110981 Two novel MYB homologues with changed expression in late embryogenesis-defective Arabidopsis mutants.1998 · DOI: 10.1023/a:1006011002499
`At3g50060`	Transcription factor involved in auxin response.	The Arabidopsis transcription factor MYB77 modulates auxin signal transduction.2007 · DOI: 10.1105/tpc.107.050963
`At2g39880`	Required for male gametophyte (pollen) development.	No verified direct reference in this release
`At3g09230`	Transcription factor MYB1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012218 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010929 positive regulation of auxin mediated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

KEGG gene cross-reference

ath:AT2G39880

ath:AT3G09230

ath:AT3G50060

ath:AT4G37260

ath:AT5G67300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · LXL04_012218 · OH-1004

Cytoplasm0.095

Rank 2 · LXL04_012218 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_012218 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_012218 · OH-1004

Plastid0.011

Rank 5 · LXL04_012218 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding17-63 aa

PF13921.13Myb_DNA-bind_620-77 aa

PF00249.38Myb_DNA-binding70-113 aa

PF13921.13Myb_DNA-bind_672-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012218	`PF00249.38`	Myb_DNA-binding	17	63	9.6e-39	132.0
LXL04_012218	`PF13921.13`	Myb_DNA-bind_6	20	77	4.1e-26	91.7
LXL04_012218	`PF00249.38`	Myb_DNA-binding	70	113	9.6e-39	132.0
LXL04_012218	`PF13921.13`	Myb_DNA-bind_6	72	116	4.1e-26	91.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23160`	Arabidopsis thaliana	Transcription factor MYB73	75.238%	Swiss-Prot	weak database homology
`Q9FDW1`	Arabidopsis thaliana	Transcription factor MYB44	72.816%	Swiss-Prot	weak database homology
`Q9SN12`	Arabidopsis thaliana	Transcription factor MYB77	69.159%	Swiss-Prot	weak database homology
`O04192`	Arabidopsis thaliana	Transcription factor MYB25	62.393%	Swiss-Prot	weak database homology
`Q42575`	Arabidopsis thaliana	Transcription factor MYB1	55.245%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card