LXL04_011974 | RubberDandelionOmics

Gene overview

LXL04_011974

Reference: OH-1004 Chr: Chr03 Coordinates: 3950865-3954880 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · LXL04_011974|LXL04_011974|OH1004|cDNA

ATGTTCCTGGAAGTGAAAGAAATCACTGAGAAAGTTGAGGTAATTTCTCACCTGTTGAGCCAGAAAGTTGAAGTCACTAAACTATCCACTCACTTGAATGTATCCCCCAGTATGGGTGCAGTCACTCTACTAGCACTCGGAAACGGCGCTCCTGATGTGTTTGCATCTGTCGCTGCTGTCGGTGGTGGCAACCCCCGAACAGGATTCGGCGCGATTTTATCAGCTGGAGCTTTCGTTTCAGCTCCCTTCGCGGTGTCCCC...

CDS

Download CDS FASTA

429 bp · LXL04_011974|LXL04_011974|OH1004|CDS

ATGTTCCTGGAAGTGAAAGAAATCACTGAGAAAGTTGAGGTAATTTCTCACCTGTTGAGCCAGAAAGTTGAAGTCACTAAACTATCCACTCACTTGAATGTATCCCCCAGTATGGGTGCAGTCACTCTACTAGCACTCGGAAACGGCGCTCCTGATGTGTTTGCATCTGTCGCTGCTGTCGGTGGTGGCAACCCCCGAACAGGATTCGGCGCGATTTTATCAGCTGGAGCTTTCGTTTCAGCTCCCTTCGCGGTGTCCCC...

Protein

Download Protein FASTA

142 aa · LXL04_011974|LXL04_011974|OH1004|PROTEIN

MFLEVKEITEKVEVISHLLSQKVEVTKLSTHLNVSPSMGAVTLLALGNGAPDVFASVAAVGGGNPRTGFGAILSAGAFVSAPFAVSPAPFIRGVLFYLTAVPVVRGSHVFFGAGKEGNTLSALLFDHIIDIYARSARFGTYN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011974`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011974

Location Chr03:3950865-3954880 (-)

Description Similar to CCX5: Cation/calcium exchanger 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08960`	May act as a membrane-localized, H⁺-dependent K⁺ and Na⁺ transporter.	Characterization of an AtCCX5 gene from Arabidopsis thaliana that involves in high-affinity K⁺ uptake and Na⁺ transport in yeast.2011 · DOI: 10.1016/j.bbrc.2011.09.030

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011974 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006812 monoatomic cation transport Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0035725 sodium ion transmembrane transport Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

GO:0051560 mitochondrial calcium ion homeostasis Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:0099093 calcium export from the mitochondrion Biological Process

GO:2001256 regulation of store-operated calcium entry Biological Process

KEGG gene cross-reference

ath:AT1G08960

cel:CELE_C07A9.11

mmu:170756

rno:498185

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.293

Rank 1 · LXL04_011974 · OH-1004

Cell membrane0.190

Rank 2 · LXL04_011974 · OH-1004

Cytoplasm0.179

Rank 3 · LXL04_011974 · OH-1004

Lysosome / Vacuole0.165

Rank 4 · LXL04_011974 · OH-1004

Golgi apparatus0.121

Rank 5 · LXL04_011974 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699.30Na_Ca_ex25-80 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011974	`PF01699.30`	Na_Ca_ex	25	80	4.2e-09	37.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04034`	Arabidopsis thaliana	Cation/calcium exchanger 5	67.442%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card