LXL04_011844 | RubberDandelionOmics

Gene overview

LXL04_011844

Reference: OH-1004 Chr: Chr03 Coordinates: 1374664-1382757 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4554 bp · LXL04_011844|LXL04_011844|OH1004|cDNA

ATGAAGTTCTCCGGAATTGTCGGCAATCACCGCCATCTCTACCGTCTCCAGAAGTCTTTAATTGCTGCTGGTAGCAGGAAACTTCAAAATGATTTAGGGATTAAGCGTAACTTGTCAGGATTGATCTCGGAAGAAGAGTCAGAACTTAAAGAATTTAATAATTATCTGGATAATCTGAAGAACCATGAAAAATCTGGTGTTCCAAAGGGCGCTGGAACCGACTCAGATGATGGTTTTGATCTTGGAAGAATGAAACGACT...

CDS

Download CDS FASTA

4554 bp · LXL04_011844|LXL04_011844|OH1004|CDS

ATGAAGTTCTCCGGAATTGTCGGCAATCACCGCCATCTCTACCGTCTCCAGAAGTCTTTAATTGCTGCTGGTAGCAGGAAACTTCAAAATGATTTAGGGATTAAGCGTAACTTGTCAGGATTGATCTCGGAAGAAGAGTCAGAACTTAAAGAATTTAATAATTATCTGGATAATCTGAAGAACCATGAAAAATCTGGTGTTCCAAAGGGCGCTGGAACCGACTCAGATGATGGTTTTGATCTTGGAAGAATGAAACGACT...

Protein

Download Protein FASTA

1517 aa · LXL04_011844|LXL04_011844|OH1004|PROTEIN

MKFSGIVGNHRHLYRLQKSLIAAGSRKLQNDLGIKRNLSGLISEEESELKEFNNYLDNLKNHEKSGVPKGAGTDSDDGFDLGRMKRLMQLLGNPHSTFKAVHIAGTKGKGSTAAFLSNILRAEGYSVGCYTSPHIKTIRERITLGRFGDPVSAKTVNSLFQRIKLVLDEAVQLEKGHLSHFEVLTAVAFNLFAEENVDIAVVEAGLGGARDATNIISSSNLAASIITTIGEEHLAALGGSLETITIAKSGIIKHGRPVVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011844`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011844

Location Chr03:1374664-1382757 (-)

Description Similar to DHFS: Dihydrofolate synthetase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41480`	Conversion of folates to polyglutamate derivatives, including tetrahydrofolate.	Tetrahydrofolate biosynthesis in plants: molecular and functional characterization of dihydrofolate synthetase and three isoforms of folylpolyglutamate synthetase in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.261585098 The GLOBULAR ARREST1 gene, which is involved in the biosynthesis of folates, is essential for embryogenesis in Arabidopsis thaliana.2003 · DOI: 10.1046/j.1365-313x.2003.01621.x
`At4g02960`	Retrovirus-related Pol polyprotein from transposon RE2.	No verified direct reference in this release
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011844 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006508 proteolysis Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0009396 folic acid-containing compound biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0015074 DNA integration Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0071897 DNA biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0042575 DNA polymerase complex Cellular Component

GO:0003676 nucleic acid binding Molecular Function

KEGG gene cross-reference

ath:AT5G41480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.331

Rank 1 · LXL04_011844 · OH-1004

Mitochondrion0.292

Rank 2 · LXL04_011844 · OH-1004

Nucleus0.178

Rank 3 · LXL04_011844 · OH-1004

Peroxisome0.126

Rank 4 · LXL04_011844 · OH-1004

Plastid0.103

Rank 5 · LXL04_011844 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08245.19Mur_ligase_M103-348 aa

PF27239.2FOL3_C392-445 aa

PF14223.15Retrotran_gag_2557-691 aa

PF00665.33rve776-857 aa

PF25597.2SH3_retrovirus930-994 aa

PF07727.20RVT_21134-1291 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011844	`PF08245.19`	Mur_ligase_M	103	348	1.3e-09	39.0
LXL04_011844	`PF27239.2`	FOL3_C	392	445	6.3e-07	30.3
LXL04_011844	`PF14223.15`	Retrotran_gag_2	557	691	2.4e-22	80.2
LXL04_011844	`PF00665.33`	rve	776	857	1.1e-09	39.2
LXL04_011844	`PF25597.2`	SH3_retrovirus	930	994	3.2e-15	56.4
LXL04_011844	`PF07727.20`	RVT_2	1134	1291	1e-50	173.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JYE9`	Arabidopsis thaliana	Dihydrofolate synthetase	66.071%	Swiss-Prot	weak database homology
`Q9ZT94`	Arabidopsis thaliana	Retrovirus-related Pol polyprotein from transposon RE2	32.220%	Swiss-Prot	weak database homology
`Q94HW2`	Arabidopsis thaliana	Retrovirus-related Pol polyprotein from transposon RE1	31.873%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card