LXL04_011577 | RubberDandelionOmics

Gene overview

LXL04_011577

Reference: OH-1004 Chr: Chr02 Coordinates: 167540414-167541454 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · LXL04_011577|LXL04_011577|OH1004|cDNA

ATGTACAACTTATACCCGCACAATGTACAACTCATTAAAGAATGGAATAGATTTGCTTATTTTCGTGACTTCTTTATAGCTGCTGTACCTATCGGGATCTGCTACGGCCGTGTAGCCAATAACCTTCCGACGCCATCCGCCGCTGTGAATCTCATCAAAACCAACGGTATCTCAAGCATCCGACTATTCAACCCTGACCCGGAGTCACTAAAGCCGTTTTCCGGCACCGGAATCAACCTCACTGTCGGAGTCCCCAACGA...

CDS

Download CDS FASTA

1041 bp · LXL04_011577|LXL04_011577|OH1004|CDS

ATGTACAACTTATACCCGCACAATGTACAACTCATTAAAGAATGGAATAGATTTGCTTATTTTCGTGACTTCTTTATAGCTGCTGTACCTATCGGGATCTGCTACGGCCGTGTAGCCAATAACCTTCCGACGCCATCCGCCGCTGTGAATCTCATCAAAACCAACGGTATCTCAAGCATCCGACTATTCAACCCTGACCCGGAGTCACTAAAGCCGTTTTCCGGCACCGGAATCAACCTCACTGTCGGAGTCCCCAACGA...

Protein

Download Protein FASTA

346 aa · LXL04_011577|LXL04_011577|OH1004|PROTEIN

MYNLYPHNVQLIKEWNRFAYFRDFFIAAVPIGICYGRVANNLPTPSAAVNLIKTNGISSIRLFNPDPESLKPFSGTGINLTVGVPNEELPSIATSTAAAAQDWLQSNIFAHVPADQIRYIVVGNEVFLKDPFYTPHVIPAIANIYEALKSIGLSEKIKISSAQAASILSNSYPPSSSYFDPNILPELNRLLQFLRDTSSPLMVNVYPYLSYINNPQFVSLDSALFRPGSSLNDQDLVYDNLFDQTVDAFIYAMEREGYGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011577`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011577

Location Chr02:167540414-167541454 (-)

Description Similar to GGL4: Glucan endo-1,3-beta-glucosidase, acidic isoform GL153

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16260`	May be involved in plant defense against cyst nematode pathogens.	The interaction of the novel 30C02 cyst nematode effector protein with a plant β-1,3-endoglucanase may suppress host defence to promote parasitism.2012 · DOI: 10.1093/jxb/ers058

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011577 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002215 defense response to nematode Biological Process

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0042973 glucan endo-1,3-beta-D-glucosidase activity Molecular Function

KEGG gene cross-reference

ath:AT4G16260

nta:107763655

nta:107789548

nta:107825406

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.313

Rank 1 · LXL04_011577 · OH-1004

Cytoplasm0.196

Rank 2 · LXL04_011577 · OH-1004

Lysosome / Vacuole0.140

Rank 3 · LXL04_011577 · OH-1004

Endoplasmic reticulum0.117

Rank 4 · LXL04_011577 · OH-1004

Cell membrane0.069

Rank 5 · LXL04_011577 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332.25Glyco_hydro_1731-345 aa

PF29664.1BtgE-BtgC_glyc-hydro47-164 aa

PF29664.1BtgE-BtgC_glyc-hydro257-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011577	`PF00332.25`	Glyco_hydro_17	31	345	2e-86	291.1
LXL04_011577	`PF29664.1`	BtgE-BtgC_glyc-hydro	47	164	2.3e-15	57.2
LXL04_011577	`PF29664.1`	BtgE-BtgC_glyc-hydro	257	331	2.3e-15	57.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZJ2`	Arabidopsis thaliana	Probable glucan endo-1,3-beta-glucosidase At4g16260	41.776%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card