LXL04_011404 | RubberDandelionOmics

Gene overview

LXL04_011404

Reference: OH-1004 Chr: Chr02 Coordinates: 163849138-163852325 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1287 bp · LXL04_011404|LXL04_011404|OH1004|cDNA

ATGGCTTCAATCATGTCTCATTTGTCTCTCCACCATGCAAAACCCTTTAACTTGAGCAATTCGTCAAGTAGAATTTCACCTGCTTTAGCTCTACGTACAAGTCAACCAACTGTGCTTTCGCTCAGAAACTCTCCGGAGAAGATACCAGCTGAATTCTCCGGCAAGCATTTGCGATTTTCCGGGTGGGATCAACTCCTGAGACGGCGGGGTTCCGTTGAAATTCCGGTGGTAAAAGCTGCAGCAGCGGCGGCGGATGGTGA...

CDS

Download CDS FASTA

1287 bp · LXL04_011404|LXL04_011404|OH1004|CDS

ATGGCTTCAATCATGTCTCATTTGTCTCTCCACCATGCAAAACCCTTTAACTTGAGCAATTCGTCAAGTAGAATTTCACCTGCTTTAGCTCTACGTACAAGTCAACCAACTGTGCTTTCGCTCAGAAACTCTCCGGAGAAGATACCAGCTGAATTCTCCGGCAAGCATTTGCGATTTTCCGGGTGGGATCAACTCCTGAGACGGCGGGGTTCCGTTGAAATTCCGGTGGTAAAAGCTGCAGCAGCGGCGGCGGATGGTGA...

Protein

Download Protein FASTA

428 aa · LXL04_011404|LXL04_011404|OH1004|PROTEIN

MASIMSHLSLHHAKPFNLSNSSSRISPALALRTSQPTVLSLRNSPEKIPAEFSGKHLRFSGWDQLLRRRGSVEIPVVKAAAAAADGDDQEIEISEGLKIAEAPKSFAERYPALVTGFFFFTWYFLNVIFNILNKKVYNYFPYPYFVSVVHLFVGVTYCLISWSIGLPKRAPINKELLGVLTPVAACHALGHVMSNVSFAAVAVSFTHTIKALEPFFSAAASQFVLGHQIPLSLWLSLAPVVLGVSMASLTELSFNWLGFT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011404`
TK1151 ID	TkA02G610760
OH-1004 ID	LXL04_011404
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.000
Protein coverage (%)	TK1151 98.366 / OH-1004 70.794 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011404

Location Chr02:163849138-163852325 (-)

Description Similar to Triose phosphate/phosphate translocator, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46110`	Triose phosphate/phosphate translocator that transports inorganic phosphate, 3-phosphoglycerate (3-PGA) and triose phosphate.	Identification of mutants of Arabidopsis defective in acclimation of photosynthesis to the light environment.2003 · DOI: 10.1104/pp.015479

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0239200`	Triose phosphate/phosphate translocator that may function in the export of photoassimilates from chloroplasts during the day.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011404 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009643 photosynthetic acclimation Biological Process

GO:0015713 phosphoglycerate transmembrane transport Biological Process

GO:0015717 triose phosphate transport Biological Process

GO:0015718 monocarboxylic acid transport Biological Process

GO:0035436 triose phosphate transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT5G46110

dosa:Os01g0239200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · LXL04_011404 · OH-1004

Endoplasmic reticulum0.039

Rank 2 · LXL04_011404 · OH-1004

Golgi apparatus0.034

Rank 3 · LXL04_011404 · OH-1004

Peroxisome0.029

Rank 4 · LXL04_011404 · OH-1004

Mitochondrion0.017

Rank 5 · LXL04_011404 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151.23TPT114-401 aa

PF00892.27EamA257-401 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011404	`PF03151.23`	TPT	114	401	5.3e-107	358.2
LXL04_011404	`PF00892.27`	EamA	257	401	5.9e-11	43.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSR7`	Arabidopsis thaliana	Triose phosphate/phosphate translocator TPT, chloroplastic	79.819%	Swiss-Prot	strong database homology
`Q9FTT3`	Oryza sativa subsp. japonica	Triose phosphate/phosphate translocator TPT, chloroplastic	77.910%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card