LXL04_009964 | RubberDandelionOmics

Gene overview

LXL04_009964

Reference: OH-1004 Chr: Chr02 Coordinates: 136866346-136868407 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

861 bp · LXL04_009964|LXL04_009964|OH1004|cDNA

ATGGGGAACATAAATGGTAGAGAAGACGGTGGTGGTGCCGGTGGCGATGGTGGTAGCACCTCATCTATCGGCAACGACGTTACGGCTCCGGACGCGAACTATATTACTCGTAGTGGCGATGATGGTGAGTTCATGGGTCACTCTCCTCCTCCAAGCCCTAGGGTTTCTGGCTCTCCGTTGATGTTCACTCCCCAGGTACCTGTGGCTCCATTACAAAGACCGGATGAGATGCAGCCAAACAATTCATGGATGCACACCTC...

CDS

Download CDS FASTA

861 bp · LXL04_009964|LXL04_009964|OH1004|CDS

ATGGGGAACATAAATGGTAGAGAAGACGGTGGTGGTGCCGGTGGCGATGGTGGTAGCACCTCATCTATCGGCAACGACGTTACGGCTCCGGACGCGAACTATATTACTCGTAGTGGCGATGATGGTGAGTTCATGGGTCACTCTCCTCCTCCAAGCCCTAGGGTTTCTGGCTCTCCGTTGATGTTCACTCCCCAGGTACCTGTGGCTCCATTACAAAGACCGGATGAGATGCAGCCAAACAATTCATGGATGCACACCTC...

Protein

Download Protein FASTA

286 aa · LXL04_009964|LXL04_009964|OH1004|PROTEIN

MGNINGREDGGGAGGDGGSTSSIGNDVTAPDANYITRSGDDGEFMGHSPPPSPRVSGSPLMFTPQVPVAPLQRPDEMQPNNSWMHTSSSYEDMMSEQGIPTMITWSYDGKDVAVEGSWDNWKTRKALQKSGKDFIILKVLPSGVYQYRFVVDGQWRYSPDVPWTQDESGNTYNILDLQEYVPEDIQSISGFDPPQSPDSSYNNLQLGCEDYAKEPPLVPPHLQMTLLNAPSPHMEIPPPSSRPQHVVINHLYMQKGRGSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009964`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009964

Location Chr02:136866346-136868407 (+)

Description Similar to KINB2: SNF1-related protein kinase regulatory subunit beta-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16360`	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.	No verified direct reference in this release
`At5g21170`	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009964 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0007165 signal transduction Biological Process

GO:0031669 cellular response to nutrient levels Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0043562 cellular response to nitrogen levels Biological Process

GO:0045859 regulation of protein kinase activity Biological Process

GO:0120162 positive regulation of cold-induced thermogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G16360

ath:AT5G21170

hsa:5565

mmu:108097

rno:64562

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · LXL04_009964 · OH-1004

Cell membrane0.319

Rank 2 · LXL04_009964 · OH-1004

Nucleus0.272

Rank 3 · LXL04_009964 · OH-1004

Lysosome / Vacuole0.090

Rank 4 · LXL04_009964 · OH-1004

Golgi apparatus0.088

Rank 5 · LXL04_009964 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16561.12AMPK1_CBM99-179 aa

PF04739.21AMPKBI212-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009964	`PF16561.12`	AMPK1_CBM	99	179	2e-31	108.7
LXL04_009964	`PF04739.21`	AMPKBI	212	283	1e-24	87.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCY5`	Arabidopsis thaliana	SNF1-related protein kinase regulatory subunit beta-2	62.925%	Swiss-Prot	strong database homology
`Q84VQ1`	Arabidopsis thaliana	SNF1-related protein kinase regulatory subunit beta-1	50.175%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card