LXL04_008773 | RubberDandelionOmics

Gene overview

LXL04_008773

Reference: OH-1004 Chr: Chr02 Coordinates: 108500505-108501597 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

657 bp · LXL04_008773|LXL04_008773|OH1004|cDNA

ATGGCGTCTTCCCTCTGTACAAGAATCTACCGTTCTTTTCTCTCAGCTAACCCTATTACTAATCACCACCAATCTCTACTAATTTCTCTCCACCATTTCTCCACCGAAACCTCCTCCGAGTCTGATTCCGATTCCACTATCCATCCAAAACCCGAATCAGACCCGTTACCCCAATCTCCCGATTCTAATGCCCGACAAAGGGACTTCGGAGACCGCCCACTTGAAAACGGGCTAGATATTGGCGTTTACAGGGCGATATT...

CDS

Download CDS FASTA

657 bp · LXL04_008773|LXL04_008773|OH1004|CDS

ATGGCGTCTTCCCTCTGTACAAGAATCTACCGTTCTTTTCTCTCAGCTAACCCTATTACTAATCACCACCAATCTCTACTAATTTCTCTCCACCATTTCTCCACCGAAACCTCCTCCGAGTCTGATTCCGATTCCACTATCCATCCAAAACCCGAATCAGACCCGTTACCCCAATCTCCCGATTCTAATGCCCGACAAAGGGACTTCGGAGACCGCCCACTTGAAAACGGGCTAGATATTGGCGTTTACAGGGCGATATT...

Protein

Download Protein FASTA

218 aa · LXL04_008773|LXL04_008773|OH1004|PROTEIN

MASSLCTRIYRSFLSANPITNHHQSLLISLHHFSTETSSESDSDSTIHPKPESDPLPQSPDSNARQRDFGDRPLENGLDIGVYRAILIGKVGQNPIEKKLRSGRTVTMLSIGTGGMRNNRRPLQNEEPRDYANRSMIQWHRVSIYPERLGALVVKNAVPGAILYMEGNLETKIFNDPITGVTRRVREIAIRGDGRIVFLEKGSDAQEDRAEIKGVGYY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008773`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008773

Location Chr02:108500505-108501597 (-)

Description Similar to At4g11060: Single-stranded DNA-binding protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11060`	Binds to ss-DNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008773 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0090297 positive regulation of mitochondrial DNA replication Biological Process

GO:0090615 mitochondrial mRNA processing Biological Process

GO:0009295 nucleoid Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042645 mitochondrial nucleoid Cellular Component

GO:0003697 single-stranded DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008047 enzyme activator activity Molecular Function

KEGG gene cross-reference

ath:AT4G11060

atu:Atu1512

rbe:RBE_0161

rco:RC1295

rpr:RP836

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.718

Rank 1 · LXL04_008773 · OH-1004

Plastid0.186

Rank 2 · LXL04_008773 · OH-1004

Nucleus0.071

Rank 3 · LXL04_008773 · OH-1004

Cytoplasm0.027

Rank 4 · LXL04_008773 · OH-1004

Cell membrane0.007

Rank 5 · LXL04_008773 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00436.32SSB84-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008773	`PF00436.32`	SSB	84	191	8.7e-13	48.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84J78`	Arabidopsis thaliana	Single-stranded DNA-binding protein, mitochondrial	34.969%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card