Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2580 bp · LXL04_008010|LXL04_008010|OH1004|cDNA
ATGGATCCTTCAATAATGAAGTTCCTCGAAGAAGACGAGGATGAAACAATGCATTCAGGGGCTGACGTTGAGGCATTCACTGCTGCCCTAAACAGAGATATCGAAGGGGACACCACTTCAACATCTCAGCCTCCCACTACCACAGATGCAGGCGGAGGTTTATCTCAAGGAACGAATCATACTCCAAGCCAGCTGTTTCAACAATGGCAATCTGCCAACCGTGAAGGAAACACCAATTACTCTAACGAAGAGGAAGTTAA...
2580 bp · LXL04_008010|LXL04_008010|OH1004|CDS
ATGGATCCTTCAATAATGAAGTTCCTCGAAGAAGACGAGGATGAAACAATGCATTCAGGGGCTGACGTTGAGGCATTCACTGCTGCCCTAAACAGAGATATCGAAGGGGACACCACTTCAACATCTCAGCCTCCCACTACCACAGATGCAGGCGGAGGTTTATCTCAAGGAACGAATCATACTCCAAGCCAGCTGTTTCAACAATGGCAATCTGCCAACCGTGAAGGAAACACCAATTACTCTAACGAAGAGGAAGTTAA...
Protein
Download Protein FASTA859 aa · LXL04_008010|LXL04_008010|OH1004|PROTEIN
MDPSIMKFLEEDEDETMHSGADVEAFTAALNRDIEGDTTSTSQPPTTTDAGGGLSQGTNHTPSQLFQQWQSANREGNTNYSNEEEVKPKIHEQQSSAMEVNRHGSGSEVQHPPNDTSRVPSEPTRPQDDQHKVHTSQTMNTDKTPVQEPSLSRNPENESQMQRMHRMGNNQQPMPTTGQSANALNRPSGKQVPFALLLPVIEPQLDKDRAMQLQGLYVRLRNNNINKEEFVRHMRSLVGDHMLKMAVFKLQQGQQSGKLN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008010 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008010 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:80268070-80272372 (+) | |||||||||
| Description | Similar to TAF4B: Transcription initiation factor TFIID subunit 4b | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006282 regulation of DNA repair Biological Process GO:0006352 DNA-templated transcription initiation Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process GO:0007283 spermatogenesis Biological Process GO:0042789 mRNA transcription by RNA polymerase II Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process GO:0000785 chromatin Cellular Component GO:0001650 fibrillar center Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G27720 ath:AT5G43130 dme:Dmel_CG5444 hsa:6874 hsa:6875 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12174.14RST186-252 aaPF05236.21TAF4553-848 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_008010 | PF12174.14 | RST | 186 | 252 | 1.9e-22 | 79.6 |
| LXL04_008010 | PF05236.21 | TAF4 | 553 | 848 | 5.4e-74 | 250.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.