LXL04_007338 | RubberDandelionOmics

Gene overview

LXL04_007338

Reference: OH-1004 Chr: Chr02 Coordinates: 44738227-44741692 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1338 bp · LXL04_007338|LXL04_007338|OH1004|cDNA

ATGTTCTTGTTAAACGCTCAACTCCACCAACAAACCACCCTTTCTTCTCTCCTTCCAACCACCTCTTCTACCTGCCTATCTAAAACCCACCACAAAACCCAACCATTGCTCTTCCGTAAACCCACCTTATCGTTCCTTCAATTCTCcctccaccaccacccccaACAACAATTATACACCAACGTCAACAGAGACGATGAAGTAtacgaagaagaagaggaacaAGTAATCGGAGACTGCTTGGTTTTCGAAGAAGGCAT...

CDS

Download CDS FASTA

1338 bp · LXL04_007338|LXL04_007338|OH1004|CDS

ATGTTCTTGTTAAACGCTCAACTCCACCAACAAACCACCCTTTCTTCTCTCCTTCCAACCACCTCTTCTACCTGCCTATCTAAAACCCACCACAAAACCCAACCATTGCTCTTCCGTAAACCCACCTTATCGTTCCTTCAATTCTCCCTCCACCACCACCCCCAACAACAATTATACACCAACGTCAACAGAGACGATGAAGTATACGAAGAAGAAGAGGAACAAGTAATCGGAGACTGCTTGGTTTTCGAAGAAGGCAT...

Protein

Download Protein FASTA

445 aa · LXL04_007338|LXL04_007338|OH1004|PROTEIN

MFLLNAQLHQQTTLSSLLPTTSSTCLSKTHHKTQPLLFRKPTLSFLQFSLHHHPQQQLYTNVNRDDEVYEEEEEQVIGDCLVFEEGIFEDPYIQNEIQLEAPKPSKKVTKIVVQPEDLVPAYWKDVQTEINITKKERRKMAQELEFGSRLQKRKEGLKPIPMGYESMKEYKAAKLRELNPVRLDNPEFLVEKKEDDGTEDEIDEGEGSRGTRVAPRNPKMAVYGRNMEDISRYLNSGMYDPEAAKDPDGPRKLFTKEEKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007338`
TK1151 ID	TkA03G159440
OH-1004 ID	LXL04_007338
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007338

Location Chr02:44738227-44741692 (+)

Description Similar to AKRP: Ankyrin repeat domain-containing protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66055`	Involved in the initial differentiation of the proplastid during the embryo development and in plastid differentiation linked to cell differentiation, morphogenesis and organogenesis during the plant life cycle.	No verified direct reference in this release
`At5g40160`	Involved in the initial differentiation of the proplastid during the embryo development.	Uncovering the post-embryonic role of embryo essential genes in Arabidopsis using the controlled induction of visibly marked genetic mosaics: EMB506, an illustration.2006 · DOI: 10.1007/s11103-006-6268-6

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007338 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0031398 positive regulation of protein ubiquitination Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0043409 negative regulation of MAPK cascade Biological Process

GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process

GO:0070682 proteasome regulatory particle assembly Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G40160

ath:AT5G66055

hsa:5716

rno:116722

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.934

Rank 1 · LXL04_007338 · OH-1004

Nucleus0.050

Rank 2 · LXL04_007338 · OH-1004

Mitochondrion0.041

Rank 3 · LXL04_007338 · OH-1004

Cytoplasm0.018

Rank 4 · LXL04_007338 · OH-1004

Cell membrane0.015

Rank 5 · LXL04_007338 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_2272-339 aa

PF13637.13Ank_4280-329 aa

PF13857.13Ank_5299-349 aa

PF12796.14Ank_2322-405 aa

PF13637.13Ank_4323-362 aa

PF13857.13Ank_5329-382 aa

PF00023.37Ank341-373 aa

PF13606.13Ank_3341-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007338	`PF12796.14`	Ank_2	272	339	3.2e-26	92.4
LXL04_007338	`PF13637.13`	Ank_4	280	329	3.5e-24	85.0
LXL04_007338	`PF13857.13`	Ank_5	299	349	5.7e-27	94.2
LXL04_007338	`PF12796.14`	Ank_2	322	405	3.2e-26	92.4
LXL04_007338	`PF13637.13`	Ank_4	323	362	3.5e-24	85.0
LXL04_007338	`PF13857.13`	Ank_5	329	382	5.7e-27	94.2
LXL04_007338	`PF00023.37`	Ank	341	373	1.1e-25	89.0
LXL04_007338	`PF13606.13`	Ank_3	341	369	2.9e-19	67.6
LXL04_007338	`PF13637.13`	Ank_4	355	395	3.5e-24	85.0
LXL04_007338	`PF00023.37`	Ank	374	405	1.1e-25	89.0
LXL04_007338	`PF13606.13`	Ank_3	374	399	2.9e-19	67.6
LXL04_007338	`PF13857.13`	Ank_5	377	415	5.7e-27	94.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q05753`	Arabidopsis thaliana	Ankyrin repeat domain-containing protein, chloroplastic	49.095%	Swiss-Prot	moderate database homology
`Q9SQK3`	Arabidopsis thaliana	Ankyrin repeat domain-containing protein EMB506, chloroplastic	42.995%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card