LXL04_006463 | RubberDandelionOmics

Gene overview

LXL04_006463

Reference: OH-1004 Chr: Chr02 Coordinates: 11355798-11357229 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_006463|LXL04_006463|OH1004|cDNA

ATGGGGGCGATGACGTCGTCCGTGGCGGCGAAGTTCGCTTTTTTTCCGCCGGATCCGCCGTCATATAAAGTGGTGGTGGACGAATCGAGCGATAGTGGGAAATTGAAGATGACGGATGTGGCCGAGAGAGACAACGTCGACGTTCTGAAGCTGAAAACGAAAAGGGGAACGGAGATCGTGGCGGCGTATGTGAAGAATCCGGTGGCGTCACTCACTGTACTTTACTCTCACGGCAACGCCGCTGATCTCGGTCAGATGTA...

CDS

Download CDS FASTA

1002 bp · LXL04_006463|LXL04_006463|OH1004|CDS

ATGGGGGCGATGACGTCGTCCGTGGCGGCGAAGTTCGCTTTTTTTCCGCCGGATCCGCCGTCATATAAAGTGGTGGTGGACGAATCGAGCGATAGTGGGAAATTGAAGATGACGGATGTGGCCGAGAGAGACAACGTCGACGTTCTGAAGCTGAAAACGAAAAGGGGAACGGAGATCGTGGCGGCGTATGTGAAGAATCCGGTGGCGTCACTCACTGTACTTTACTCTCACGGCAACGCCGCTGATCTCGGTCAGATGTA...

Protein

Download Protein FASTA

333 aa · LXL04_006463|LXL04_006463|OH1004|PROTEIN

MGAMTSSVAAKFAFFPPDPPSYKVVVDESSDSGKLKMTDVAERDNVDVLKLKTKRGTEIVAAYVKNPVASLTVLYSHGNAADLGQMYDLFCELSAHLRVNLMGYDYTGYGQSSGKPSEQNTYADIEAAYRCLEETYGVKEEDVILYGQSVGSGPTLDLAARLPRLRAVVLHSPILSGIRVMYPVKRTYWFDIYKNIDKIPLVKCPVLIIHGTDDDVVDYSHGKQLYELCVEKYEPLWIKGGNHCDLELYPEYIRHLKKFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006463`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_006463`
Location	Chr02:11355798-11357229 (-)
Description	Similar to ABHD17B: Alpha/beta hydrolase domain-containing protein 17B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006463` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002084 protein depalmitoylation Biological Process GO:1902473 regulation of protein localization to synapse Biological Process GO:1902817 negative regulation of protein localization to microtubule Biological Process GO:1905668 positive regulation of protein localization to endosome Biological Process GO:0005886 plasma membrane Cellular Component GO:0010008 endosome membrane Cellular Component GO:0016020 membrane Cellular Component GO:0055038 recycling endosome membrane Cellular Component GO:0008474 palmitoyl-(protein) hydrolase activity Molecular Function
KEGG gene cross-reference	gga:427252 hsa:51104 mmu:226016 rno:309399 xtr:448619 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.512

Rank 1 · LXL04_006463 · OH-1004

Cytoplasm0.267

Rank 2 · LXL04_006463 · OH-1004

Endoplasmic reticulum0.165

Rank 3 · LXL04_006463 · OH-1004

Nucleus0.130

Rank 4 · LXL04_006463 · OH-1004

Golgi apparatus0.124

Rank 5 · LXL04_006463 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146.16Hydrolase_472-178 aa

PF00561.27Abhydrolase_173-173 aa

PF00326.28Peptidase_S9118-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006463	`PF12146.16`	Hydrolase_4	72	178	2.5e-14	53.9
LXL04_006463	`PF00561.27`	Abhydrolase_1	73	173	7.2e-10	39.7
LXL04_006463	`PF00326.28`	Peptidase_S9	118	231	1e-06	29.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card