LXL04_005432 | RubberDandelionOmics

Gene overview

LXL04_005432

Reference: OH-1004 Chr: Chr01 Coordinates: 163821548-163822120 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · LXL04_005432|LXL04_005432|OH1004|cDNA

ATGACACTTCCACTTGGGAAAGCAAACTTAAACCTCAAAGGCTATCAATTCAATATGAAgttcttctctcttcttctcatATTTCTCTTTCTTGGCCTCTTTGAAGCTCCATTAATGGTGATGGGAGATAGAAAGCTGATAGAAAGCACGTGCAAGGCCACACCTTCATACAATCTttgtctctcaactctcttaTCAAACCCCAAAAGTTTAAGTGGTGATGTTAGTGACTTGGGACTAATCATGGTGGGTGCAACTCG...

CDS

Download CDS FASTA

573 bp · LXL04_005432|LXL04_005432|OH1004|CDS

ATGACACTTCCACTTGGGAAAGCAAACTTAAACCTCAAAGGCTATCAATTCAATATGAAGTTCTTCTCTCTTCTTCTCATATTTCTCTTTCTTGGCCTCTTTGAAGCTCCATTAATGGTGATGGGAGATAGAAAGCTGATAGAAAGCACGTGCAAGGCCACACCTTCATACAATCTTTGTCTCTCAACTCTCTTATCAAACCCCAAAAGTTTAAGTGGTGATGTTAGTGACTTGGGACTAATCATGGTGGGTGCAACTCG...

Protein

Download Protein FASTA

190 aa · LXL04_005432|LXL04_005432|OH1004|PROTEIN

MTLPLGKANLNLKGYQFNMKFFSLLLIFLFLGLFEAPLMVMGDRKLIESTCKATPSYNLCLSTLLSNPKSLSGDVSDLGLIMVGATRIKATQAVQHIKSLYRSHPELRRPLNECAQMYLAVVKADVPSAIQALDGGQPKFAEDGMADTAVEAQACERSFSDGGHKSPVTEMNKGVENIANVARAIIRMLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005432`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005432

Location Chr01:163821548-163822120 (-)

Description Similar to C/VIF1: Cell wall / vacuolar inhibitor of fructosidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47960`	Inhibits fructosidases from vacuoles (vacuolar invertase VI).	In Arabidopsis thaliana, the invertase inhibitors AtC/VIF1 and 2 exhibit distinct target enzyme specificities and expression profiles.2004 · DOI: 10.1016/j.febslet.2004.07.062
`At5g64620`	Inhibits fructosidases from both cell wall (cell wall invertase CWI) and vacuoles (vacuolar invertase VI).	In Arabidopsis thaliana, the invertase inhibitors AtC/VIF1 and 2 exhibit distinct target enzyme specificities and expression profiles.2004 · DOI: 10.1016/j.febslet.2004.07.062
`At3g17220`	Inhibits pectin methylesterase (PME) from flowers, siliques and pollen tube.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005432 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009827 plant-type cell wall modification Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0043086 negative regulation of catalytic activity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0048046 apoplast Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

GO:0046910 pectinesterase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G47960

ath:AT3G17220

ath:AT5G64620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.449

Rank 1 · LXL04_005432 · OH-1004

Lysosome / Vacuole0.186

Rank 2 · LXL04_005432 · OH-1004

Endoplasmic reticulum0.142

Rank 3 · LXL04_005432 · OH-1004

Cytoplasm0.121

Rank 4 · LXL04_005432 · OH-1004

Cell membrane0.107

Rank 5 · LXL04_005432 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043.21PMEI45-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005432	`PF04043.21`	PMEI	45	185	2.9e-18	67.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HWQ8`	Arabidopsis thaliana	Cell wall / vacuolar inhibitor of fructosidase 1	45.000%	Swiss-Prot	moderate database homology
`O49603`	Arabidopsis thaliana	Cell wall / vacuolar inhibitor of fructosidase 2	31.200%	Swiss-Prot	moderate database homology
`Q9LUV1`	Arabidopsis thaliana	Pectinesterase inhibitor 2	24.691%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card