Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2364 bp · LXL04_004771|LXL04_004771|OH1004|cDNA
ATGGGAGCGAGTAGAAAGCTTCAAGGCGAGATCGATCGGGTATTGAAGAAAGTCCAGGAAGGAGTTTACGATACTGACAATGCCAATCAGAAGGAGAAATTTGAAGCCGATTTGAAGAAGGAGATCAAGAAACTTCAGAGGTACAGAGACCAGATTAAGACATGGATACAGTCCAGCGAGATCAAGGATAAAAAGGCTCTAATGGATGCTCGTAAGCTTATCGAAAAAGAAATGGAACGATTTAAGATATGTGAAAAGGA...
2364 bp · LXL04_004771|LXL04_004771|OH1004|CDS
ATGGGAGCGAGTAGAAAGCTTCAAGGCGAGATCGATCGGGTATTGAAGAAAGTCCAGGAAGGAGTTTACGATACTGACAATGCCAATCAGAAGGAGAAATTTGAAGCCGATTTGAAGAAGGAGATCAAGAAACTTCAGAGGTACAGAGACCAGATTAAGACATGGATACAGTCCAGCGAGATCAAGGATAAAAAGGCTCTAATGGATGCTCGTAAGCTTATCGAAAAAGAAATGGAACGATTTAAGATATGTGAAAAGGA...
Protein
Download Protein FASTA787 aa · LXL04_004771|LXL04_004771|OH1004|PROTEIN
MGASRKLQGEIDRVLKKVQEGVYDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKALMDARKLIEKEMERFKICEKETKTKAFSKEGLGQQPKTDPKEKAKSETRDWMNNTVSQLESQIDSFEAELEGLSVKKGKARPPRLTHLETSINRHKAHIMKLELILRLLDNDELSPEQVNDVKDFLDDYVDRNQEDFDEFDDVDELYNTLPLDKVESLEDLVTIGPPGIVKAVGSTAAVLTIKSPLSTSAQMPA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_004771 |
|---|---|
| TK1151 ID | TkA01G112890 |
| OH-1004 ID | LXL04_004771 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 92.300 |
| Protein coverage (%) | TK1151 96.019 / OH-1004 52.478Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_004771 |
|---|---|
| Location | Chr01:145741920-145746275 (-) |
| Description | Similar to CNOT3: CCR4-NOT transcription complex subunit 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006402 mRNA catabolic process Biological Process GO:0006417 regulation of translation Biological Process GO:0007368 determination of left/right symmetry Biological Process GO:0010467 gene expression Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process GO:0120162 positive regulation of cold-induced thermogenesis Biological Process GO:2000036 regulation of stem cell population maintenance Biological Process |
| KEGG gene cross-reference | hsa:4849 mmu:232791 spo:2542126 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04065.21Not34-218 aaPF04153.25NOT2_3_5_C618-731 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_004771 | PF04065.21 | Not3 | 4 | 218 | 1.8e-75 | 254.0 |
| LXL04_004771 | PF04153.25 | NOT2_3_5_C | 618 | 731 | 5.5e-30 | 104.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.