LXL04_003562 | RubberDandelionOmics

Gene overview

LXL04_003562

Reference: OH-1004 Chr: Chr01 Coordinates: 86034546-86038278 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2439 bp · LXL04_003562|LXL04_003562|OH1004|cDNA

ATGGATTCCTTTGGCGGCTCATACTTCACCGACGAGAAAGCAGCGAAGGTCGAGAATATCTTCTTGGAGTTCCTTAAAAGTTTTAGATTAGATGCGCATTCAAGAGAACCTTTCTACGAGTCAGAAATCGAAGCAATGAGACCAAATGAGTCCAACACCATGTTTATTGATTTCTCTCATGTTATGAGGTTCAGCGATATTCTACAGAAGGCCATATCTGATGAATATCTGAGGTTTGAGTCGTACCTGAAGAACGCATG...

CDS

Download CDS FASTA

2439 bp · LXL04_003562|LXL04_003562|OH1004|CDS

ATGGATTCCTTTGGCGGCTCATACTTCACCGACGAGAAAGCAGCGAAGGTCGAGAATATCTTCTTGGAGTTCCTTAAAAGTTTTAGATTAGATGCGCATTCAAGAGAACCTTTCTACGAGTCAGAAATCGAAGCAATGAGACCAAATGAGTCCAACACCATGTTTATTGATTTCTCTCATGTTATGAGGTTCAGCGATATTCTACAGAAGGCCATATCTGATGAATATCTGAGGTTTGAGTCGTACCTGAAGAACGCATG...

Protein

Download Protein FASTA

812 aa · LXL04_003562|LXL04_003562|OH1004|PROTEIN

MDSFGGSYFTDEKAAKVENIFLEFLKSFRLDAHSREPFYESEIEAMRPNESNTMFIDFSHVMRFSDILQKAISDEYLRFESYLKNACKRFVMGQKPTFITDDNPNKDINIAFYNLPVIKRLRELSTSEIGRLVSVTGVVTRTSEVRPELLQGTFKCLECGTIVKNVEQQYKYTEPMICINAMCAKKGSWTLLRQESKFADWQRVRMQETSKEIPAGSLPRSLDVILRHDIVEQARAGDTVIFTGTVVVIPDIFALSAPGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003562`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003562

Location Chr01:86034546-86038278 (+)

Description Similar to MCM6: DNA replication licensing factor MCM6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44635`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0235800`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release
`UniProt: B8AZX3`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003562 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000727 double-strand break repair via break-induced replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006279 premeiotic DNA replication Biological Process

GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process

GO:0044786 cell cycle DNA replication Biological Process

GO:1902969 mitotic DNA replication Biological Process

GO:1902975 mitotic DNA replication initiation Biological Process

GO:0000347 THO complex Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005656 nuclear pre-replicative complex Cellular Component

KEGG gene cross-reference

ath:AT5G44635

dosa:Os05g0235800

spo:2540784

xtr:548975

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927

Rank 1 · LXL04_003562 · OH-1004

Cytoplasm0.137

Rank 2 · LXL04_003562 · OH-1004

Mitochondrion0.035

Rank 3 · LXL04_003562 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_003562 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_003562 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14551.12MCM_N19-114 aa

PF17207.10MCM_OB121-249 aa

PF00493.30MCM335-557 aa

PF01078.28Mg_chelatase444-511 aa

PF17855.8MCM_lid572-656 aa

PF18263.8WHD_MCM6698-811 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003562	`PF14551.12`	MCM_N	19	114	1.5e-13	51.7
LXL04_003562	`PF17207.10`	MCM_OB	121	249	2.3e-41	141.2
LXL04_003562	`PF00493.30`	MCM	335	557	2.6e-101	338.1
LXL04_003562	`PF01078.28`	Mg_chelatase	444	511	7.8e-07	29.4
LXL04_003562	`PF17855.8`	MCM_lid	572	656	2.6e-24	86.2
LXL04_003562	`PF18263.8`	WHD_MCM6	698	811	6.2e-21	75.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KAB8`	Arabidopsis thaliana	DNA replication licensing factor MCM6	71.909%	Swiss-Prot	strong database homology
`Q6F353`	Oryza sativa subsp. japonica	DNA replication licensing factor MCM6	72.749%	Swiss-Prot	strong database homology
`B8AZX3`	Oryza sativa subsp. indica	DNA replication licensing factor MCM6	72.629%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card